Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 5 6.2e+02 1.0 0.0 48 98 45 97 34 107 0.73

2 3 2.5e-28 3.1e-26 92.1 0.5 1 109 177 284 177 285 0.92

3 3 5 6.1e+02 1.0 0.0 81 107 291 317 286 319 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	5	6.2e+02	1.0	0.0	48	98	45	97	34	107	0.73
2	3	2.5e-28	3.1e-26	92.1	0.5	1	109	177	284	177	285	0.92
3	3	5	6.1e+02	1.0	0.0	81	107	291	317	286	319	0.82

Coding Sequence: ATGTCTTGTGAAAAAGATACGACTACGACCGAAATCTCGAACTCGAACGGAGAGCTATTTAATTACGAATGGCGAATCGACAATTTAGGAGAACTTGAAAACGCATCAGCAGCTTTTTACAAAACTATCACTATATCGAGCGTTAATACGATACAAATCAAAGTGAAACGTTCTCCGGTGCAGATTCATTATTTGCCCGATTATCTTCACGAGGCTAAAATTCGTATACGAGATATTTCCTTAGAAGCGATCGTATCATGCAACTCATCTGTGtataaaatgaccaattgCAGCGTACTGCTTCATTCACTTGTCGACGATCTAAGCGATGGTGATGTCGTGGTGAATAATATATTCGGCGAATCGGAAGAACAAACAAAAGTTAACGAACATCTTACTGTTTATAAACATACCGATGTCATGACATATGAATGTCCTAAACCGAACGATTTGCTTACGCTagtttgtaaaattcaaattatattttcttcCCAGGATATCAGCGTGAATAGCAATCCTCGTATCAATTTCGGACGTTTATTTGATAATAATCAATTCACCGACTTCATCTTCACAGTGAGTGGAGTAGAATTCCATATCCATAAAGCAATTCTAGCGCTTTACAGTCCGGTATTcgaagatatttttgaaaacgactTGTTGGCGGAAAAGAAGGATAATCGTGCTGTAATCAACGACTTTAATCCGAAAGTATTTAAAGAAGTGTTACGTTTTATCTACACCGGtgaaatcgagaatttttacgaaattgcattggaattattgaaaatcgcTGACAAGTACGAAATCAAAGCACTGAAAACTGTTTGCGAACAACGTATGTGTGTCCATCTGTTGGATTTACCAGTCGAAGATGCGATAGTGCTATTGGCCTGTGCAGATATGTATCGTTGCGAATGGTTGAAATCAAGAATTATCGAATTCATTGTTTCTCGTCCCAATTCGATTGTAACAACGGTCGCTTGGAAAgagttcattttaaaaaatccaaaattgacgAACGAAGTTCGTGATGCCATGATTCGTGCGAGAGTTCCTTTgtgtttttaa
Protein Sequence: MSCEKDTTTTEISNSNGELFNYEWRIDNLGELENASAAFYKTITISSVNTIQIKVKRSPVQIHYLPDYLHEAKIRIRDISLEAIVSCNSSVYKMTNCSVLLHSLVDDLSDGDVVVNNIFGESEEQTKVNEHLTVYKHTDVMTYECPKPNDLLTLVCKIQIIFSSQDISVNSNPRINFGRLFDNNQFTDFIFTVSGVEFHIHKAILALYSPVFEDIFENDLLAEKKDNRAVINDFNPKVFKEVLRFIYTGEIENFYEIALELLKIADKYEIKALKTVCEQRMCVHLLDLPVEDAIVLLACADMYRCEWLKSRIIEFIVSRPNSIVTTVAWKEFILKNPKLTNEVRDAMIRARVPLCF

Sequence clustering based on sequence similarity using MMseqs2