Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.17 98 4.1 0.2 21 43 21 43 18 51 0.86

2 6 1.1 6.8e+02 1.5 0.1 20 43 47 70 44 78 0.82

3 6 1.7e-05 0.0098 16.9 0.0 20 47 103 130 99 135 0.88

4 6 0.13 77 4.5 0.0 21 48 132 158 130 161 0.88

5 6 0.053 31 5.7 0.4 20 44 162 186 155 193 0.82

6 6 0.19 1.1e+02 4.0 0.2 17 43 187 213 185 218 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.17	98	4.1	0.2	21	43	21	43	18	51	0.86
2	6	1.1	6.8e+02	1.5	0.1	20	43	47	70	44	78	0.82
3	6	1.7e-05	0.0098	16.9	0.0	20	47	103	130	99	135	0.88
4	6	0.13	77	4.5	0.0	21	48	132	158	130	161	0.88
5	6	0.053	31	5.7	0.4	20	44	162	186	155	193	0.82
6	6	0.19	1.1e+02	4.0	0.2	17	43	187	213	185	218	0.83

Coding Sequence: ATGTGCGACACGAAGCTTTCATCTCGGCGATGCTTAAAAAATCACATGATcgtacacaccggcgagaagccgttcgcctGCGATCTCTGCGACTACAAGTGCCGCCATTACCCGAACTTGAAGCAGCACAGGTTAACGCACAGCGAAAAATCGCTGAGCTGCgacgtttgcgattataaatgtcgataTTCCTACAGCATGAAGCTGCACAAGCTGaaacacaccaacgagaagcgCTACAGTTGCGACCTGTGCGACTATAAGTGCTTCATAGCGGCGCGACTGAAACAGCACATgctgacgcacaacagcgagaagccgttcacctGCGGTCTCTGCGATAATAAATTCCGGCAGCTGACGCAATTGAAGCGGCACTTgttgatacacaccggcgagaagccgttcggctgcgacctctgcgattataagaCTCGCGACAACTCGATGCTGAAGCGGCACAAGATGAGACACTCCAGCGACGTCTCCGACAAGCGGTTCAGATGCGACGTTTGCGACTTTAAGTGTCGGCGAAAGGAAAACTTGAAAAGGCACAGGtcgatacacaccggcgagaagctgTTAAGCTGCGGCCTTTGTGATTACAAGAGTCGATGCCCGAAGAACTTGAAGCGGCACACTTTGAGCCACGGCCTTAGTGAGACGAAAACGGAGGCCTTTTCGCTGGTACTTTGCAAAACGGAAGTGGAATAA
Protein Sequence: MCDTKLSSRRCLKNHMIVHTGEKPFACDLCDYKCRHYPNLKQHRLTHSEKSLSCDVCDYKCRYSYSMKLHKLKHTNEKRYSCDLCDYKCFIAARLKQHMLTHNSEKPFTCGLCDNKFRQLTQLKRHLLIHTGEKPFGCDLCDYKTRDNSMLKRHKMRHSSDVSDKRFRCDVCDFKCRRKENLKRHRSIHTGEKLLSCGLCDYKSRCPKNLKRHTLSHGLSETKTEAFSLVLCKTEVE

Sequence clustering based on sequence similarity using MMseqs2