Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.088 52 5.0 0.1 21 47 8 34 6 41 0.81

2 7 3.9 2.3e+03 -0.3 4.1 24 43 39 58 33 75 0.57

3 7 0.17 99 4.1 3.3 5 44 59 98 56 103 0.79

4 7 0.0038 2.3 9.4 0.1 21 49 103 130 100 134 0.88

5 7 0.033 19 6.4 0.1 18 48 128 157 126 160 0.87

6 7 0.0093 5.5 8.1 0.2 21 52 159 190 154 192 0.85

7 7 0.0019 1.1 10.4 0.2 20 46 211 237 199 240 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.088	52	5.0	0.1	21	47	8	34	6	41	0.81
2	7	3.9	2.3e+03	-0.3	4.1	24	43	39	58	33	75	0.57
3	7	0.17	99	4.1	3.3	5	44	59	98	56	103	0.79
4	7	0.0038	2.3	9.4	0.1	21	49	103	130	100	134	0.88
5	7	0.033	19	6.4	0.1	18	48	128	157	126	160	0.87
6	7	0.0093	5.5	8.1	0.2	21	52	159	190	154	192	0.85
7	7	0.0019	1.1	10.4	0.2	20	46	211	237	199	240	0.88

Coding Sequence: ATGCACCTGTTAATACATAGCGACGAGAAACCCGTCGGTTGTAGCCTGTGTGATTACAGGTGTCGGCTGCCCGGCGCTTTAAAACGACACATGCTGACGCACTCCAATAAGAAGCCGCTCGTGTGTGatatttgcgattataaatgccgaacCCTCGGTAATTTGAAAGAGCACAGATGCCGCCAGCCGTCACATTTGAGACGGCACGTGCTgaggcacaccggcgagaagccttacggttgcgatctctgcgattacaaatgccgaacctccggacatttgaaacagcacatgttacaacacaccggcgagaaacctttCGGCTGTgacgtttgcgattataagtgccgggGGATCAGTAATTTGAGAAAGCACAAGTTAAGGCACAccaacgagaaaccgttcagttgcgatctcTGCGATCATAAATGCCGAACATCCGGACACTTGAAACAGCACAAGCTGAAGCATACCGACGAGAAGCCTTTCGCCTGTGATCTTTGCAATTATAAGTGTCGACGCCTCGGCGATTTGAGAAGGCACAAATTGAAACGCACCGACGAGAAACCATCCAGTGTTAATCTTTGCGGTTATAAAAGCGGAAGATCGCAAGAGCACAGTTTAACGCACACCAGCGAGAAGCACTTCATCTGTGGCCTTTGCGATTTCGAGTGTCGTCAGCGTGAAACGTTGAGGCGGCATTTGTCGGTACACATGGAAGATGAAACGTCGTag
Protein Sequence: MHLLIHSDEKPVGCSLCDYRCRLPGALKRHMLTHSNKKPLVCDICDYKCRTLGNLKEHRCRQPSHLRRHVLRHTGEKPYGCDLCDYKCRTSGHLKQHMLQHTGEKPFGCDVCDYKCRGISNLRKHKLRHTNEKPFSCDLCDHKCRTSGHLKQHKLKHTDEKPFACDLCNYKCRRLGDLRRHKLKRTDEKPSSVNLCGYKSGRSQEHSLTHTSEKHFICGLCDFECRQRETLRRHLSVHMEDETS

Sequence clustering based on sequence similarity using MMseqs2