Pinq024303.1
Basic Information
- Insect
- Prosopocoilus inquinatus
- Gene Symbol
- -
- Assembly
- GCA_036172665.1
- Location
- CM069876.1:47901497-47906577[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.088 52 5.0 0.1 21 47 8 34 6 41 0.81 2 7 3.9 2.3e+03 -0.3 4.1 24 43 39 58 33 75 0.57 3 7 0.17 99 4.1 3.3 5 44 59 98 56 103 0.79 4 7 0.0038 2.3 9.4 0.1 21 49 103 130 100 134 0.88 5 7 0.033 19 6.4 0.1 18 48 128 157 126 160 0.87 6 7 0.0093 5.5 8.1 0.2 21 52 159 190 154 192 0.85 7 7 0.0019 1.1 10.4 0.2 20 46 211 237 199 240 0.88
Sequence Information
- Coding Sequence
- ATGCACCTGTTAATACATAGCGACGAGAAACCCGTCGGTTGTAGCCTGTGTGATTACAGGTGTCGGCTGCCCGGCGCTTTAAAACGACACATGCTGACGCACTCCAATAAGAAGCCGCTCGTGTGTGatatttgcgattataaatgccgaacCCTCGGTAATTTGAAAGAGCACAGATGCCGCCAGCCGTCACATTTGAGACGGCACGTGCTgaggcacaccggcgagaagccttacggttgcgatctctgcgattacaaatgccgaacctccggacatttgaaacagcacatgttacaacacaccggcgagaaacctttCGGCTGTgacgtttgcgattataagtgccgggGGATCAGTAATTTGAGAAAGCACAAGTTAAGGCACAccaacgagaaaccgttcagttgcgatctcTGCGATCATAAATGCCGAACATCCGGACACTTGAAACAGCACAAGCTGAAGCATACCGACGAGAAGCCTTTCGCCTGTGATCTTTGCAATTATAAGTGTCGACGCCTCGGCGATTTGAGAAGGCACAAATTGAAACGCACCGACGAGAAACCATCCAGTGTTAATCTTTGCGGTTATAAAAGCGGAAGATCGCAAGAGCACAGTTTAACGCACACCAGCGAGAAGCACTTCATCTGTGGCCTTTGCGATTTCGAGTGTCGTCAGCGTGAAACGTTGAGGCGGCATTTGTCGGTACACATGGAAGATGAAACGTCGTag
- Protein Sequence
- MHLLIHSDEKPVGCSLCDYRCRLPGALKRHMLTHSNKKPLVCDICDYKCRTLGNLKEHRCRQPSHLRRHVLRHTGEKPYGCDLCDYKCRTSGHLKQHMLQHTGEKPFGCDVCDYKCRGISNLRKHKLRHTNEKPFSCDLCDHKCRTSGHLKQHKLKHTDEKPFACDLCNYKCRRLGDLRRHKLKRTDEKPSSVNLCGYKSGRSQEHSLTHTSEKHFICGLCDFECRQRETLRRHLSVHMEDETS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01258624;
- 90% Identity
- iTF_01258624;
- 80% Identity
- iTF_01258624;