Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.0042 2.5 9.2 0.1 19 44 4 29 1 37 0.87

2 8 0.00044 0.26 12.4 0.3 21 50 62 90 50 95 0.87

3 8 1.8 1.1e+03 0.8 0.1 22 44 91 113 87 117 0.86

4 8 0.0021 1.3 10.2 0.0 21 45 118 142 115 149 0.89

5 8 2.8 1.7e+03 0.2 0.3 26 44 151 169 146 173 0.87

6 8 0.073 43 5.3 0.1 21 44 174 197 170 205 0.86

7 8 0.63 3.7e+02 2.3 0.0 21 47 202 228 199 233 0.82

8 8 0.34 2e+02 3.1 0.0 21 43 230 252 227 258 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.0042	2.5	9.2	0.1	19	44	4	29	1	37	0.87
2	8	0.00044	0.26	12.4	0.3	21	50	62	90	50	95	0.87
3	8	1.8	1.1e+03	0.8	0.1	22	44	91	113	87	117	0.86
4	8	0.0021	1.3	10.2	0.0	21	45	118	142	115	149	0.89
5	8	2.8	1.7e+03	0.2	0.3	26	44	151	169	146	173	0.87
6	8	0.073	43	5.3	0.1	21	44	174	197	170	205	0.86
7	8	0.63	3.7e+02	2.3	0.0	21	47	202	228	199	233	0.82
8	8	0.34	2e+02	3.1	0.0	21	43	230	252	227	258	0.87

Coding Sequence: ATGTCGACGCACACCAGCGAGAAACGTTTCAGCTGTGCCctgtgcgattacaaatgcaaGCAATCCGGAAATATGAAGCGGCACGCGTTAATACACACCAACGAGAAGTCTTTCAGTTGTGcgctttgcgattacaaatgctcGCTGGCCCCCAGCCTGAAACGGCACatgttaacgcacaccgacgagaaacctcTCAGTTGTACCCTCTGCGACTACAAGTGCCGGCAACCGGAGAACTTGAGGGCGCACATGTTGAAACACACCGGCAAGAAACCGTTCGcctgtgacctttgcgattataaatgccggtaTAAAGGAGCACTGACACGTCACATGTTAACGCACACGGGCGAGAAGCCCTTCacttgtgacctttgcgattacaagtgcggACAAAGCGAATATCTGAAAAGGCACATGTTAATACACGCCGATAGGAAATCTTTtagttgcgatctttgcgattgcAGATGCCGGCGATCCGATGAATTGGATCAGCACATGTTAACACACAGCGGTGAGAAGCCGATTGGTTGTAGTtcctgcgattataagtgccggcAAGTCGGAACGATGAAGCGACACATGTTGACGCATACAGGCGAGAAACCCTTCGGCTGTgacgtttgcgattataaatgtcgacggcCCGATTTTCTGAAGCAACACATGATAATACATACTAGTGAGAAACCTTTCCGTTGCAGTCTCTGTGATTACAGAGGCAAACTATCCAAACACTTGAAGAAGCACAGGTTGACACACAGTGGCGAAAAGTCGACGGAGCATAGCGAAGGGAAGGCACATATGCACACTTACTGA
Protein Sequence: MSTHTSEKRFSCALCDYKCKQSGNMKRHALIHTNEKSFSCALCDYKCSLAPSLKRHMLTHTDEKPLSCTLCDYKCRQPENLRAHMLKHTGKKPFACDLCDYKCRYKGALTRHMLTHTGEKPFTCDLCDYKCGQSEYLKRHMLIHADRKSFSCDLCDCRCRRSDELDQHMLTHSGEKPIGCSSCDYKCRQVGTMKRHMLTHTGEKPFGCDVCDYKCRRPDFLKQHMIIHTSEKPFRCSLCDYRGKLSKHLKKHRLTHSGEKSTEHSEGKAHMHTY

Sequence clustering based on sequence similarity using MMseqs2