Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 2.4 1.4e+03 0.4 0.1 20 33 5 18 3 33 0.73

2 7 0.042 25 6.1 0.0 22 51 35 64 32 67 0.84

3 7 0.64 3.8e+02 2.3 0.1 22 43 63 84 56 89 0.82

4 7 0.059 35 5.6 0.0 20 47 89 116 74 121 0.83

5 7 0.0003 0.18 12.9 0.1 21 52 118 149 116 150 0.88

6 7 0.46 2.7e+02 2.7 0.2 21 43 146 168 142 172 0.78

7 7 0.0024 1.4 10.0 0.3 16 49 170 200 161 204 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	2.4	1.4e+03	0.4	0.1	20	33	5	18	3	33	0.73
2	7	0.042	25	6.1	0.0	22	51	35	64	32	67	0.84
3	7	0.64	3.8e+02	2.3	0.1	22	43	63	84	56	89	0.82
4	7	0.059	35	5.6	0.0	20	47	89	116	74	121	0.83
5	7	0.0003	0.18	12.9	0.1	21	52	118	149	116	150	0.88
6	7	0.46	2.7e+02	2.7	0.2	21	43	146	168	142	172	0.78
7	7	0.0024	1.4	10.0	0.3	16	49	170	200	161	204	0.81

Coding Sequence: ATGTTAACACACACCAGCGAGAAGCCGTACAATTGTGATTTTTGTGACTACAAATGCCAACGAATCGACGGGTTGAAAAGTCACATTTTAATACACGCCGACGAAAAGCCATACATCTGTAACGTTTGCAGCAAGAAATTCCGACAGAAAGGGGAACTGAACGGACACATGCGAACACACTCCGACACGAAGCCGTTCCGttgcgacctctgcgattacagATGCAAAAAATCCGGAAACTTGAAGATCCACAGgataacgcacaccgacgagaagccgttcggatGTGATCTTTGCAACTTTAAATGCCAACAGCTCGGTAGTTTAAAAAGGCACAAGTTGTtacacaccggcgaaaagccgttcagctgtgagCTCTGCGATTACAAAACCCGACAGAACAAAAATCTGCAACAGCACATGCGAATGCACAATGACGAAAAGCCGTTCGGCTGTAATATTTGCGGTTACCAGTCCCGACAGAGGGGACATGTGACGGAGCACATGcgaacgcacaccggcgagaagccgttcagctgtaGTATTTGCGGCCACCAAGCCCGCAAGAGCGGACATTTAAAAGAGCACATGCGACACACAGCGGCGAGAAGCTCTTCAGTTCTGACCTTTGTGACCGTAAATGCCGGACgttcttaa
Protein Sequence: MLTHTSEKPYNCDFCDYKCQRIDGLKSHILIHADEKPYICNVCSKKFRQKGELNGHMRTHSDTKPFRCDLCDYRCKKSGNLKIHRITHTDEKPFGCDLCNFKCQQLGSLKRHKLLHTGEKPFSCELCDYKTRQNKNLQQHMRMHNDEKPFGCNICGYQSRQRGHVTEHMRTHTGEKPFSCSICGHQARKSGHLKEHMRHTAARSSSVLTFVTVNAGRS

Sequence clustering based on sequence similarity using MMseqs2