Pinq024258.1
Basic Information
- Insect
- Prosopocoilus inquinatus
- Gene Symbol
- -
- Assembly
- GCA_036172665.1
- Location
- CM069876.1:47369093-47369749[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 2.4 1.4e+03 0.4 0.1 20 33 5 18 3 33 0.73 2 7 0.042 25 6.1 0.0 22 51 35 64 32 67 0.84 3 7 0.64 3.8e+02 2.3 0.1 22 43 63 84 56 89 0.82 4 7 0.059 35 5.6 0.0 20 47 89 116 74 121 0.83 5 7 0.0003 0.18 12.9 0.1 21 52 118 149 116 150 0.88 6 7 0.46 2.7e+02 2.7 0.2 21 43 146 168 142 172 0.78 7 7 0.0024 1.4 10.0 0.3 16 49 170 200 161 204 0.81
Sequence Information
- Coding Sequence
- ATGTTAACACACACCAGCGAGAAGCCGTACAATTGTGATTTTTGTGACTACAAATGCCAACGAATCGACGGGTTGAAAAGTCACATTTTAATACACGCCGACGAAAAGCCATACATCTGTAACGTTTGCAGCAAGAAATTCCGACAGAAAGGGGAACTGAACGGACACATGCGAACACACTCCGACACGAAGCCGTTCCGttgcgacctctgcgattacagATGCAAAAAATCCGGAAACTTGAAGATCCACAGgataacgcacaccgacgagaagccgttcggatGTGATCTTTGCAACTTTAAATGCCAACAGCTCGGTAGTTTAAAAAGGCACAAGTTGTtacacaccggcgaaaagccgttcagctgtgagCTCTGCGATTACAAAACCCGACAGAACAAAAATCTGCAACAGCACATGCGAATGCACAATGACGAAAAGCCGTTCGGCTGTAATATTTGCGGTTACCAGTCCCGACAGAGGGGACATGTGACGGAGCACATGcgaacgcacaccggcgagaagccgttcagctgtaGTATTTGCGGCCACCAAGCCCGCAAGAGCGGACATTTAAAAGAGCACATGCGACACACAGCGGCGAGAAGCTCTTCAGTTCTGACCTTTGTGACCGTAAATGCCGGACgttcttaa
- Protein Sequence
- MLTHTSEKPYNCDFCDYKCQRIDGLKSHILIHADEKPYICNVCSKKFRQKGELNGHMRTHSDTKPFRCDLCDYRCKKSGNLKIHRITHTDEKPFGCDLCNFKCQQLGSLKRHKLLHTGEKPFSCELCDYKTRQNKNLQQHMRMHNDEKPFGCNICGYQSRQRGHVTEHMRTHTGEKPFSCSICGHQARKSGHLKEHMRHTAARSSSVLTFVTVNAGRS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01258548;
- 90% Identity
- iTF_01258548;
- 80% Identity
- iTF_01258548;