Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 1.2 6.9e+02 1.4 0.2 26 47 14 35 10 40 0.87

2 8 0.87 5.2e+02 1.8 0.1 21 46 37 62 34 68 0.84

3 8 0.011 6.5 7.9 0.5 21 48 65 91 62 94 0.91

4 8 0.0039 2.3 9.3 0.1 18 44 90 116 89 120 0.89

5 8 0.0026 1.5 9.9 0.0 20 44 120 144 118 149 0.91

6 8 0.028 16 6.6 0.0 21 44 149 172 146 180 0.86

7 8 0.34 2e+02 3.1 0.2 21 44 177 200 174 208 0.86

8 8 0.71 4.2e+02 2.1 0.0 22 44 206 228 202 232 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	1.2	6.9e+02	1.4	0.2	26	47	14	35	10	40	0.87
2	8	0.87	5.2e+02	1.8	0.1	21	46	37	62	34	68	0.84
3	8	0.011	6.5	7.9	0.5	21	48	65	91	62	94	0.91
4	8	0.0039	2.3	9.3	0.1	18	44	90	116	89	120	0.89
5	8	0.0026	1.5	9.9	0.0	20	44	120	144	118	149	0.91
6	8	0.028	16	6.6	0.0	21	44	149	172	146	180	0.86
7	8	0.34	2e+02	3.1	0.2	21	44	177	200	174	208	0.86
8	8	0.71	4.2e+02	2.1	0.0	22	44	206	228	202	232	0.87

Coding Sequence: ATGGCATTCGCGCGAGAACTTTTCGacaataaattattcatttgtCACATTTGCGGTTCGAAATTCAAAGCGCGCAAGTATCTCACCCGGCACATTCCGCTGCACACCGGCGAGaggccgttcagttgcgattaCTGCGAGTACAAGTGCCGAGAGGCGGGAACTCTGAAGCAGCACGTTTtgatacacaccgacgagaagccgttcagttgtgaacGTTGCAATTACAGGTGTCGCCAGGGGGGGACGCTGAAGCGGCACATGCTgaggcacaccgacgagaaaccgttctgGTGTCACCTCTGCGATTACAGGAGCCGAGATTCGGGAAATTTGCGGCAGCACATGTTCATACACTccagcgagaagccgttcagttgcgatctttgcgattataagtgcagGCGCTCCGGAAATTTGAAGCTGCACATGTTGGTGCACAGCGACGAGAGGCCGTTTACTTGCGACGTGTGCGATTATAAAGGCCGACATCTGTCGACGTTGAAGCGGCACATGTTGACGCActccggcgagaagccgtttgGTTGTGATcgttgcgattacaagtgccggaAGGCCAGCAGGTTGAGGCAGCACGTCTTGACGCACGGCGACGAGAAGCCCTTCAGTTGTGACGTTTGTGATTTTAAATGTGAAGCGTCCAAGATGTTAAAGATGCACATGACGACACACACCGACGAAAGTGCGACCAAACAAGCAGAGAATCGGAAGAAGTAA
Protein Sequence: MAFARELFDNKLFICHICGSKFKARKYLTRHIPLHTGERPFSCDYCEYKCREAGTLKQHVLIHTDEKPFSCERCNYRCRQGGTLKRHMLRHTDEKPFWCHLCDYRSRDSGNLRQHMFIHSSEKPFSCDLCDYKCRRSGNLKLHMLVHSDERPFTCDVCDYKGRHLSTLKRHMLTHSGEKPFGCDRCDYKCRKASRLRQHVLTHGDEKPFSCDVCDFKCEASKMLKMHMTTHTDESATKQAENRKK

Sequence clustering based on sequence similarity using MMseqs2