Pinq024371.1
Basic Information
- Insect
- Prosopocoilus inquinatus
- Gene Symbol
- -
- Assembly
- GCA_036172665.1
- Location
- CM069876.1:48855765-48856502[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 8 1.2 6.9e+02 1.4 0.2 26 47 14 35 10 40 0.87 2 8 0.87 5.2e+02 1.8 0.1 21 46 37 62 34 68 0.84 3 8 0.011 6.5 7.9 0.5 21 48 65 91 62 94 0.91 4 8 0.0039 2.3 9.3 0.1 18 44 90 116 89 120 0.89 5 8 0.0026 1.5 9.9 0.0 20 44 120 144 118 149 0.91 6 8 0.028 16 6.6 0.0 21 44 149 172 146 180 0.86 7 8 0.34 2e+02 3.1 0.2 21 44 177 200 174 208 0.86 8 8 0.71 4.2e+02 2.1 0.0 22 44 206 228 202 232 0.87
Sequence Information
- Coding Sequence
- ATGGCATTCGCGCGAGAACTTTTCGacaataaattattcatttgtCACATTTGCGGTTCGAAATTCAAAGCGCGCAAGTATCTCACCCGGCACATTCCGCTGCACACCGGCGAGaggccgttcagttgcgattaCTGCGAGTACAAGTGCCGAGAGGCGGGAACTCTGAAGCAGCACGTTTtgatacacaccgacgagaagccgttcagttgtgaacGTTGCAATTACAGGTGTCGCCAGGGGGGGACGCTGAAGCGGCACATGCTgaggcacaccgacgagaaaccgttctgGTGTCACCTCTGCGATTACAGGAGCCGAGATTCGGGAAATTTGCGGCAGCACATGTTCATACACTccagcgagaagccgttcagttgcgatctttgcgattataagtgcagGCGCTCCGGAAATTTGAAGCTGCACATGTTGGTGCACAGCGACGAGAGGCCGTTTACTTGCGACGTGTGCGATTATAAAGGCCGACATCTGTCGACGTTGAAGCGGCACATGTTGACGCActccggcgagaagccgtttgGTTGTGATcgttgcgattacaagtgccggaAGGCCAGCAGGTTGAGGCAGCACGTCTTGACGCACGGCGACGAGAAGCCCTTCAGTTGTGACGTTTGTGATTTTAAATGTGAAGCGTCCAAGATGTTAAAGATGCACATGACGACACACACCGACGAAAGTGCGACCAAACAAGCAGAGAATCGGAAGAAGTAA
- Protein Sequence
- MAFARELFDNKLFICHICGSKFKARKYLTRHIPLHTGERPFSCDYCEYKCREAGTLKQHVLIHTDEKPFSCERCNYRCRQGGTLKRHMLRHTDEKPFWCHLCDYRSRDSGNLRQHMFIHSSEKPFSCDLCDYKCRRSGNLKLHMLVHSDERPFTCDVCDYKGRHLSTLKRHMLTHSGEKPFGCDRCDYKCRKASRLRQHVLTHGDEKPFSCDVCDFKCEASKMLKMHMTTHTDESATKQAENRKK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01258558;
- 90% Identity
- iTF_01258558;
- 80% Identity
- iTF_01258558;