Basic Information

Insect: Prosopocoilus inquinatus
Gene Symbol: -
Assembly: GCA_036172665.1
Location: CM069876.1:47918060-47927131[+]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.089 53 5.0 0.3 21 44 8 31 5 41 0.86

2 11 0.0016 0.93 10.6 0.3 21 44 64 87 50 96 0.79

3 11 0.6 3.5e+02 2.4 0.1 21 43 92 114 88 119 0.89

4 11 0.095 57 4.9 1.1 13 43 112 142 104 154 0.81

5 11 8.6 5.1e+03 -1.4 0.1 26 47 153 173 148 179 0.84

6 11 0.019 11 7.2 0.1 14 46 181 213 167 219 0.84

7 11 0.19 1.1e+02 4.0 0.0 21 43 216 238 213 244 0.89

8 11 0.12 70 4.6 0.0 21 44 244 267 239 275 0.87

9 11 3.7 2.2e+03 -0.2 0.1 21 43 272 294 269 304 0.76

10 11 0.00017 0.1 13.7 0.1 21 47 328 353 321 358 0.89

11 11 0.034 20 6.4 0.4 22 48 357 382 352 383 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.089	53	5.0	0.3	21	44	8	31	5	41	0.86
2	11	0.0016	0.93	10.6	0.3	21	44	64	87	50	96	0.79
3	11	0.6	3.5e+02	2.4	0.1	21	43	92	114	88	119	0.89
4	11	0.095	57	4.9	1.1	13	43	112	142	104	154	0.81
5	11	8.6	5.1e+03	-1.4	0.1	26	47	153	173	148	179	0.84
6	11	0.019	11	7.2	0.1	14	46	181	213	167	219	0.84
7	11	0.19	1.1e+02	4.0	0.0	21	43	216	238	213	244	0.89
8	11	0.12	70	4.6	0.0	21	44	244	267	239	275	0.87
9	11	3.7	2.2e+03	-0.2	0.1	21	43	272	294	269	304	0.76
10	11	0.00017	0.1	13.7	0.1	21	47	328	353	321	358	0.89
11	11	0.034	20	6.4	0.4	22	48	357	382	352	383	0.86

Sequence Information

Coding Sequence: ATGCACAAGTTAATACACAGCGACGAGAAACCGTTGGCttgcgatctctgcgattacagGTGCCGACAGCACAGCGCCTTGAAGAAgcacaagttaacgcacaccgacgagaaaccgttcggttgtgatctttgcgattacagatGCCAACGCCTCGGAACCTTGAAGGAGCACAAGCTGAATCACAGCGaggagaagccgttcagctgtgacctttgcgattatagatgTCGACAGCCGCGTTATCTGAGGACCCACatgttaacgcacaccgacgagaagccgttcagttgcgatgtTTGCGGTTATAAGTGCCGACATCTCGGAAGCTTAAAGAGGCACAAGTCAAatcacaccgacgagaaaccgttcagttgtaatCGTTGTAATTACAACTGCCGGAAGCTTCGAGATCTGGAAAAGCACAAATTAACGCACGTCGACTTGAAACTGTTCAGTTGTGAACTTTGCAGTTATAAATCTCGGCAGATCATACATTTAAAACAGCACATGTTAAAGCACACCGGCGAGAGCCAATGGACGCCTAAGGCTAAGGCGGCGAACGAGAAAACAATCGAATGCCGGCTGtgcgattctaaatttaaatctcGCCGAAATTTGCTCAAGCACATcttaatacacaccgacgagaagccgttcagttgcgatctcTGCGTTTACAAGTGCCGCCAGCTCGGAAGCCTGAAAAAGCACAAGCTAAcccacaccgacgagaaaccgttcggttgcggtctttgcgattacaaaggCCGACAACTCTCCGACCTGAAAAGGCACACGttgacgcacaccgacgagaaaccgatTAGTTGcgatctgtgcgattataaatgcgaGTTTTTGAGTACTTTGAAACGACACGCGTTGAAGCACACCGGCGAGAGACCGTTCGgctgtgatctctgcgattacaagtgcggACGGCTCGGTCACCTGAGGGAGCACAAgctgacgcacaccgacgagaaaccgttcagctgtgacGTTTGCAGTTACAAGTGCCGCCAGTCAACGAATTTAAAACAGCACATGCTGAAGCACGCCGACGAGAAGTCGTTCACTTGCGACATCTGCGGTTGCAAGTGTCGATACGCTTCGACTTTGAAACGGCACAAACTAAAACATgttctctaa
Protein Sequence: MHKLIHSDEKPLACDLCDYRCRQHSALKKHKLTHTDEKPFGCDLCDYRCQRLGTLKEHKLNHSEEKPFSCDLCDYRCRQPRYLRTHMLTHTDEKPFSCDVCGYKCRHLGSLKRHKSNHTDEKPFSCNRCNYNCRKLRDLEKHKLTHVDLKLFSCELCSYKSRQIIHLKQHMLKHTGESQWTPKAKAANEKTIECRLCDSKFKSRRNLLKHILIHTDEKPFSCDLCVYKCRQLGSLKKHKLTHTDEKPFGCGLCDYKGRQLSDLKRHTLTHTDEKPISCDLCDYKCEFLSTLKRHALKHTGERPFGCDLCDYKCGRLGHLREHKLTHTDEKPFSCDVCSYKCRQSTNLKQHMLKHADEKSFTCDICGCKCRYASTLKRHKLKHVL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01258495;
90% Identity: iTF_01258495;
80% Identity: iTF_01258495;