Basic Information

Insect: Prosopocoilus inquinatus
Gene Symbol: -
Assembly: GCA_036172665.1
Location: CM069876.1:47654379-47655473[+]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 3.1 1.8e+03 0.1 0.2 20 36 55 72 47 83 0.75

2 11 0.11 64 4.7 0.1 21 43 84 106 80 111 0.90

3 11 0.048 28 5.9 0.1 24 48 115 138 107 144 0.80

4 11 0.4 2.3e+02 2.9 0.0 21 48 140 166 136 170 0.86

5 11 0.24 1.4e+02 3.6 0.3 21 43 168 190 163 195 0.87

6 11 0.081 48 5.1 0.0 21 46 196 220 194 224 0.87

7 11 0.0062 3.7 8.7 0.1 20 48 223 250 219 254 0.87

8 11 1.1 6.6e+02 1.5 0.1 22 43 253 274 249 279 0.85

9 11 0.5 3e+02 2.6 0.1 21 46 280 305 275 311 0.83

10 11 0.036 21 6.3 0.0 22 44 309 331 306 335 0.91

11 11 0.00017 0.1 13.7 0.1 21 44 336 359 332 363 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	3.1	1.8e+03	0.1	0.2	20	36	55	72	47	83	0.75
2	11	0.11	64	4.7	0.1	21	43	84	106	80	111	0.90
3	11	0.048	28	5.9	0.1	24	48	115	138	107	144	0.80
4	11	0.4	2.3e+02	2.9	0.0	21	48	140	166	136	170	0.86
5	11	0.24	1.4e+02	3.6	0.3	21	43	168	190	163	195	0.87
6	11	0.081	48	5.1	0.0	21	46	196	220	194	224	0.87
7	11	0.0062	3.7	8.7	0.1	20	48	223	250	219	254	0.87
8	11	1.1	6.6e+02	1.5	0.1	22	43	253	274	249	279	0.85
9	11	0.5	3e+02	2.6	0.1	21	46	280	305	275	311	0.83
10	11	0.036	21	6.3	0.0	22	44	309	331	306	335	0.91
11	11	0.00017	0.1	13.7	0.1	21	44	336	359	332	363	0.91

Sequence Information

Coding Sequence: ATGATGGGGGGCAAAAAAGCGCTCGAACGCGGCAGCGTGCGTGGTTCTAAATCGAAATCTCAGAGATATACGTGCCCACACACGTCGACACATCCCGGTGAGAAACCGTACCGTTGCGAGTTTTCCGATGATTGTAAATCGCAACAGGACAGGTTTTCACATGCGAGGGAGAAACCGTTGAGCTGCGATTTATGCGATTACAAATGTCTTCGCCGCACACATTTCAAACAACATATTCttacgcacaccgacgagaaaccgtacaGTTGTAacctctgcgattacaagtgccgccAGCTGGGAAACTTGAAGCTGCACAAGGCgaaacacaccgacgagatGCGTTTCGCCTGCGgcttttgcgattataaatgccgacaagTGGGAAATTTGAAGCGGCACAGCTTAAAgcacaccggcgaaaagccgTTCGGCTGCGAGCTTTGCGGTTACAAATGCCGTAACCTGGGGAACTTGAAGCAGCACAAGCTAAAAcacgccgacgagaagccgttcgcttgCGAGCTTTGCGATTACAGTTGTCGACGGCGCGAGGACCTGAGATCTCACGCGCTGATTCACacggacgagaagccgttcagctgcgacgtctgcgattataagtgccgttACGCGGGGAACCTGAAACAGCACAAGCTCAAGCACgacggcgagaagccgttcggctgCGACCTCTGCGACTATAAATGTCGGCACGCCAGCAACTTGAAACGCCACAAGTTGAAGCACACCGACGAAAAGCAGTTGGGCTGTGAGctctgcgattttaaatgccgaaGACTGGGAAACTTGAAGCGGCACAAGatgacgcacaccgacgagagaCCGTTCGTTTGCGGACTTTGCGATTACAGTTGCCGGCGGCATGAGGATCTGAAATCTCACGTGTTGATACACAtgggcgagaagccgttcggttgtggtgtttgcgattataaatgcagaCATGCGGGGAATTTGAAGAAGCACATGCTGGTGCATACAGGCGAGAAGCCGTTGGGTTGCGAACTTTGCGGGTATAAATGCCGAAATGGCAGAAATTTGAGGCGGCACATGATGAAACACAATATTTGA
Protein Sequence: MMGGKKALERGSVRGSKSKSQRYTCPHTSTHPGEKPYRCEFSDDCKSQQDRFSHAREKPLSCDLCDYKCLRRTHFKQHILTHTDEKPYSCNLCDYKCRQLGNLKLHKAKHTDEMRFACGFCDYKCRQVGNLKRHSLKHTGEKPFGCELCGYKCRNLGNLKQHKLKHADEKPFACELCDYSCRRREDLRSHALIHTDEKPFSCDVCDYKCRYAGNLKQHKLKHDGEKPFGCDLCDYKCRHASNLKRHKLKHTDEKQLGCELCDFKCRRLGNLKRHKMTHTDERPFVCGLCDYSCRRHEDLKSHVLIHMGEKPFGCGVCDYKCRHAGNLKKHMLVHTGEKPLGCELCGYKCRNGRNLRRHMMKHNI

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01258551;
90% Identity: iTF_01258551;
80% Identity: iTF_01258551;