Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.58 3.5e+02 2.4 0.3 17 48 6 36 3 38 0.82

2 7 0.0009 0.53 11.4 1.0 18 44 35 61 30 66 0.88

3 7 0.012 7.2 7.8 0.1 21 47 66 91 62 98 0.85

4 7 0.051 30 5.8 0.0 21 48 98 124 92 129 0.83

5 7 0.0015 0.86 10.7 1.1 21 48 153 180 136 183 0.90

6 7 1.2 7.1e+02 1.4 0.0 26 48 183 204 181 209 0.84

7 7 0.12 69 4.6 0.0 20 31 234 246 231 262 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.58	3.5e+02	2.4	0.3	17	48	6	36	3	38	0.82
2	7	0.0009	0.53	11.4	1.0	18	44	35	61	30	66	0.88
3	7	0.012	7.2	7.8	0.1	21	47	66	91	62	98	0.85
4	7	0.051	30	5.8	0.0	21	48	98	124	92	129	0.83
5	7	0.0015	0.86	10.7	1.1	21	48	153	180	136	183	0.90
6	7	1.2	7.1e+02	1.4	0.0	26	48	183	204	181	209	0.84
7	7	0.12	69	4.6	0.0	20	31	234	246	231	262	0.80

Coding Sequence: ATGAAGCTGCACAAATCaaaacacaccggcgagaagcggTTCAGGTGTACTCTCTGCGAATACAAATGCGTCGAGGCCGTAAATCTAGAGCGGCATGTGTTGAGACACAGCGGGGAGAAGCCGTTCGTTTGCGGCGTTTGCGAATACAAGTGCAGGCAACGCGCGAACTTGAGCCGTCACATgttaacgcacaccggcgagaagccgttcgcttgCGAACTTTGCGACTACAAGAGCCGCGAAAGCTCAAAGTTGAAGCGACATAAATTAACGCATCACTCTCCTGACTCCGTCGAGGAGCCGTTCATTTGCAAAATCTGCAATTACGAGTATGGAAACTTAGTAAACTTAAAGCGGCACATGTGGATGCACGCCGCGAAGCGCTTCGACTGCGAgctctgcgattataaaagcCGATCGCGGACGAACTTGAAGACGCATagattaacgcacaccgacgataAGCCGAACAGTTGTGGCCTTTGCGATTACAGGTGTCGGCACCCTTCGAATTTGAAGCGGCACATCGCGTTAATGCACGAACCGAGTTGTAAtatttgcggttataagttccGGGACTCGCAGGAGATGAGTCAGCACAAGTTAAAACATGTCGATGGGGAGGGGAGGTACAGTTGCGAGCTTTGCGAGTTCAAGTCCTTAAAAGCCGGAAGTTTGCAGCAGCACCTgttgacgcacaacagcgagaAACCGTTCACTTGTGAAGTTTGCGGTTACAAAACCCAACGGCGCGGGACTTTCAACCAACATGTTAACGCGCACCGGCGAAAAGCTCAGTTACAGACTTTGTAA
Protein Sequence: MKLHKSKHTGEKRFRCTLCEYKCVEAVNLERHVLRHSGEKPFVCGVCEYKCRQRANLSRHMLTHTGEKPFACELCDYKSRESSKLKRHKLTHHSPDSVEEPFICKICNYEYGNLVNLKRHMWMHAAKRFDCELCDYKSRSRTNLKTHRLTHTDDKPNSCGLCDYRCRHPSNLKRHIALMHEPSCNICGYKFRDSQEMSQHKLKHVDGEGRYSCELCEFKSLKAGSLQQHLLTHNSEKPFTCEVCGYKTQRRGTFNQHVNAHRRKAQLQTL

Sequence clustering based on sequence similarity using MMseqs2