Pinq024451.1
Basic Information
- Insect
- Prosopocoilus inquinatus
- Gene Symbol
- -
- Assembly
- GCA_036172665.1
- Location
- CM069876.1:49636964-49637512[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.055 32 5.7 0.0 22 47 7 32 4 38 0.84 2 6 0.67 4e+02 2.2 0.0 21 48 34 60 32 65 0.84 3 6 0.055 33 5.7 0.0 21 43 66 88 57 94 0.86 4 6 0.0038 2.2 9.4 0.1 21 47 94 120 90 125 0.86 5 6 0.0013 0.79 10.8 0.2 21 44 122 145 120 149 0.91 6 6 0.019 11 7.2 0.2 21 48 150 176 147 180 0.88
Sequence Information
- Coding Sequence
- ATgttaacacacaccggcgaCAAGCCGTTCGGTTGCGATCTTTGCGGTTATGAATGCCGACAGGTCGGGAGCTTAAACCGCCACATGTTAATACATAcaggcgagaagccgttcggctgtgatctttgcgattataaatgtcgacacgCCGGAAGCCTGAAAGAGCACAAGCTAAAGCACAAGCTGAAACGCGttgacgagaagccgttcggctgtgatctttgcgattatagatTCCGACAGGCCGGACACTTGAAGCAGCACAAGCtgacacacaccgacgagaagccgttcaggtGTGcactttgcgattataaatgtcgccAGACCGGTTATTTAAAGAGGCACATGTTAATACAcacgggcgagaagccgttcagttgtgatctatGCGATTACGAATGCCGACTCACCTCGAATTTAAGACGGCACATGCTGACGCACGCCGACGAAAAGCCGTTGAGTTGTCAAGTTTGCGACTTTAAATGCCGACATCACGGGAACCTGAAGAAGCACAAGTTAAAACACGCCGGCGAGAATCCGGTGTGA
- Protein Sequence
- MLTHTGDKPFGCDLCGYECRQVGSLNRHMLIHTGEKPFGCDLCDYKCRHAGSLKEHKLKHKLKRVDEKPFGCDLCDYRFRQAGHLKQHKLTHTDEKPFRCALCDYKCRQTGYLKRHMLIHTGEKPFSCDLCDYECRLTSNLRRHMLTHADEKPLSCQVCDFKCRHHGNLKKHKLKHAGENPV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01258614;
- 90% Identity
- iTF_01258614;
- 80% Identity
- iTF_01258614;