Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.055 32 5.7 0.0 22 47 7 32 4 38 0.84

2 6 0.67 4e+02 2.2 0.0 21 48 34 60 32 65 0.84

3 6 0.055 33 5.7 0.0 21 43 66 88 57 94 0.86

4 6 0.0038 2.2 9.4 0.1 21 47 94 120 90 125 0.86

5 6 0.0013 0.79 10.8 0.2 21 44 122 145 120 149 0.91

6 6 0.019 11 7.2 0.2 21 48 150 176 147 180 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.055	32	5.7	0.0	22	47	7	32	4	38	0.84
2	6	0.67	4e+02	2.2	0.0	21	48	34	60	32	65	0.84
3	6	0.055	33	5.7	0.0	21	43	66	88	57	94	0.86
4	6	0.0038	2.2	9.4	0.1	21	47	94	120	90	125	0.86
5	6	0.0013	0.79	10.8	0.2	21	44	122	145	120	149	0.91
6	6	0.019	11	7.2	0.2	21	48	150	176	147	180	0.88

Coding Sequence: ATgttaacacacaccggcgaCAAGCCGTTCGGTTGCGATCTTTGCGGTTATGAATGCCGACAGGTCGGGAGCTTAAACCGCCACATGTTAATACATAcaggcgagaagccgttcggctgtgatctttgcgattataaatgtcgacacgCCGGAAGCCTGAAAGAGCACAAGCTAAAGCACAAGCTGAAACGCGttgacgagaagccgttcggctgtgatctttgcgattatagatTCCGACAGGCCGGACACTTGAAGCAGCACAAGCtgacacacaccgacgagaagccgttcaggtGTGcactttgcgattataaatgtcgccAGACCGGTTATTTAAAGAGGCACATGTTAATACAcacgggcgagaagccgttcagttgtgatctatGCGATTACGAATGCCGACTCACCTCGAATTTAAGACGGCACATGCTGACGCACGCCGACGAAAAGCCGTTGAGTTGTCAAGTTTGCGACTTTAAATGCCGACATCACGGGAACCTGAAGAAGCACAAGTTAAAACACGCCGGCGAGAATCCGGTGTGA
Protein Sequence: MLTHTGDKPFGCDLCGYECRQVGSLNRHMLIHTGEKPFGCDLCDYKCRHAGSLKEHKLKHKLKRVDEKPFGCDLCDYRFRQAGHLKQHKLTHTDEKPFRCALCDYKCRQTGYLKRHMLIHTGEKPFSCDLCDYECRLTSNLRRHMLTHADEKPLSCQVCDFKCRHHGNLKKHKLKHAGENPV

Sequence clustering based on sequence similarity using MMseqs2