Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.00068 0.4 11.8 1.4 20 48 21 49 13 58 0.83

2 10 3.5 2.1e+03 -0.1 0.0 21 44 50 73 48 77 0.78

3 10 0.0019 1.1 10.4 0.1 21 44 78 101 75 105 0.89

4 10 0.02 12 7.1 0.0 20 43 105 128 103 135 0.87

5 10 0.15 91 4.3 0.3 22 43 135 156 130 165 0.87

6 10 0.42 2.5e+02 2.9 0.0 21 44 162 185 157 195 0.84

7 10 0.17 99 4.1 0.0 21 48 211 237 207 240 0.90

8 10 0.012 6.9 7.8 0.4 18 43 236 261 231 266 0.89

9 10 0.01 6 8.0 0.0 21 47 267 292 263 295 0.87

10 10 0.00032 0.19 12.8 1.0 21 49 295 323 291 326 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.00068	0.4	11.8	1.4	20	48	21	49	13	58	0.83
2	10	3.5	2.1e+03	-0.1	0.0	21	44	50	73	48	77	0.78
3	10	0.0019	1.1	10.4	0.1	21	44	78	101	75	105	0.89
4	10	0.02	12	7.1	0.0	20	43	105	128	103	135	0.87
5	10	0.15	91	4.3	0.3	22	43	135	156	130	165	0.87
6	10	0.42	2.5e+02	2.9	0.0	21	44	162	185	157	195	0.84
7	10	0.17	99	4.1	0.0	21	48	211	237	207	240	0.90
8	10	0.012	6.9	7.8	0.4	18	43	236	261	231	266	0.89
9	10	0.01	6	8.0	0.0	21	47	267	292	263	295	0.87
10	10	0.00032	0.19	12.8	1.0	21	49	295	323	291	326	0.91

Coding Sequence: atgTTGGTAATGTCAGAAGAGTCTCAAAGGTTTCGACGAATCCCCGAAAGCAATGCGAACGCGAGCGAGCAAACATTCGAATGCCGAATATGTGAATCCAGGTTGAGATCGCGCGCGAAACTGCGCAGGCACattttaatacacaccggcgagaagccgttcagctgcgGCGTTTGCGAAACCAAATGCCAAGATATCAGCGGTTTGAAAACGCACATGTTAATACAcacgggcgagaagccgttcacctgcgacctttgcgattacaaatgtcgaCAGCGTAGCAACTTGAAGGTTCACATGTTGAAGCACGCaagcgagaagccgttcacttgcggtctttgcgattataaatgccgataCCTTGGAAGTTTGAAAAGACACCAGTTAGGGCACACCGAtaagaagccgttcagttgtaatctctgcgattacaaatgtcgaGACTGCAAACAGCTAAAGCGCCACAAGTTCAAGCATACCGACGAAAAGCCGTTCGGCTGTggcctctgcgattataaatgcctgGACCCGCGCAGTTTGAAACGGCACAAGTCGAAGCACGCggatgagaagccgttcactTACGCTCTCTGCGGAGACCTCGGAAATTTGAACTTGAAGCACAatgacgagaagccgttcggttgtgacctcTGCGGTTTTAAATGCCGGTACGTCGGAAGTCTGAAAAGGCACAAGTTaaggcacaccgacgagaagccgttcggctgtgatctttgcgattatagatgTCGAGAGCGCGAGAATTTGAAACGGCACACGTTCAAGCATactgacgagaagccgttcgatTGTGacatttgcgattataaatgtaaaGACCTTAGAAATTTGTTACGGCACAAGTTGAAACACAGTGATGAGAAGCCGCTCAGTTGTGAGCTTTGctattataaatgccgacattTCGCGAGTATGCGACGACACAAGTTGTTAAAGCATACTAGTCAGAGCATGACAACCCAGTAA
Protein Sequence: MLVMSEESQRFRRIPESNANASEQTFECRICESRLRSRAKLRRHILIHTGEKPFSCGVCETKCQDISGLKTHMLIHTGEKPFTCDLCDYKCRQRSNLKVHMLKHASEKPFTCGLCDYKCRYLGSLKRHQLGHTDKKPFSCNLCDYKCRDCKQLKRHKFKHTDEKPFGCGLCDYKCLDPRSLKRHKSKHADEKPFTYALCGDLGNLNLKHNDEKPFGCDLCGFKCRYVGSLKRHKLRHTDEKPFGCDLCDYRCRERENLKRHTFKHTDEKPFDCDICDYKCKDLRNLLRHKLKHSDEKPLSCELCYYKCRHFASMRRHKLLKHTSQSMTTQ

Sequence clustering based on sequence similarity using MMseqs2