Basic Information

Insect: Prosopocoilus inquinatus
Gene Symbol: -
Assembly: GCA_036172665.1
Location: CM069876.1:47327221-47329442[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 16 0.00052 0.033 15.6 4.6 1 23 3 25 3 25 0.98

2 16 0.00039 0.024 16.0 2.1 1 23 31 53 31 53 0.97

3 16 0.069 4.3 8.9 1.8 1 23 59 81 59 81 0.98

4 16 0.00013 0.0081 17.5 3.3 1 23 87 109 87 109 0.98

5 16 5.7 3.5e+02 2.9 5.5 1 23 115 137 115 137 0.97

6 16 0.0028 0.18 13.3 3.5 1 23 143 165 143 165 0.98

7 16 0.085 5.3 8.6 1.5 1 23 171 193 171 193 0.97

8 16 0.027 1.7 10.2 5.1 1 23 199 221 199 221 0.98

9 16 0.0051 0.32 12.5 2.7 1 20 227 246 227 248 0.94

10 16 0.0069 0.43 12.1 5.7 1 23 259 281 259 281 0.98

11 16 0.00013 0.0083 17.5 4.3 1 23 287 309 287 309 0.98

12 16 9.4e-05 0.0059 17.9 1.8 3 23 317 337 316 337 0.97

13 16 0.0023 0.14 13.6 9.9 1 23 343 365 343 365 0.97

14 16 0.00041 0.026 15.9 0.9 1 23 379 401 379 401 0.98

15 16 0.024 1.5 10.4 2.6 1 23 407 429 407 429 0.98

16 16 0.008 0.5 11.9 1.6 2 23 434 455 433 455 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	16	0.00052	0.033	15.6	4.6	1	23	3	25	3	25	0.98
2	16	0.00039	0.024	16.0	2.1	1	23	31	53	31	53	0.97
3	16	0.069	4.3	8.9	1.8	1	23	59	81	59	81	0.98
4	16	0.00013	0.0081	17.5	3.3	1	23	87	109	87	109	0.98
5	16	5.7	3.5e+02	2.9	5.5	1	23	115	137	115	137	0.97
6	16	0.0028	0.18	13.3	3.5	1	23	143	165	143	165	0.98
7	16	0.085	5.3	8.6	1.5	1	23	171	193	171	193	0.97
8	16	0.027	1.7	10.2	5.1	1	23	199	221	199	221	0.98
9	16	0.0051	0.32	12.5	2.7	1	20	227	246	227	248	0.94
10	16	0.0069	0.43	12.1	5.7	1	23	259	281	259	281	0.98
11	16	0.00013	0.0083	17.5	4.3	1	23	287	309	287	309	0.98
12	16	9.4e-05	0.0059	17.9	1.8	3	23	317	337	316	337	0.97
13	16	0.0023	0.14	13.6	9.9	1	23	343	365	343	365	0.97
14	16	0.00041	0.026	15.9	0.9	1	23	379	401	379	401	0.98
15	16	0.024	1.5	10.4	2.6	1	23	407	429	407	429	0.98
16	16	0.008	0.5	11.9	1.6	2	23	434	455	433	455	0.96

Sequence Information

Coding Sequence: ATGCCGTTCAGCTGCAACGTTTGCGAATACAAATGCCGCCAGATCGGACACTTGAGGCAGCACATGttgacgcacaccgacgagaaacccttcagctgtgacctttgcgattataaatcccGACAGATTTCGAACTTGAGGAgacacaagttaaagcacaccgaCGACAAACCGTTCAGCTGCGACCTTTGCGAATATAAATGCCGGGAAGTCGGGGCCTTCAAGAGGCACGAGCTGACGCACACCGACGTGAAGCCGTACGCTTGCGATCTATGCGATTACAAATTCCGACAGTTTGCGCACTTGAAACAGCACAAACTAACGCACTccggcgagaaaccgtataattgcgatctgtgcgattataaatgccgatgCATTGAATCCTTGAAGACGCATAAGCTAatgcacaccgacgagaagccgttcagttgtgatataTGCGAATATAAATGCCGATACATCGGTAACTTGAGGAGGCACAAGTTGAagcacaccaacgagaagccgttcagttgtgagcTTTGCGAGTATAAATGCCGAGAAATTGTAGCCTTGAAAAAGCACGAGTTAAGGCACACCGACGACAAGCCGTACAGTTGCGATcagtgcgattataaatgccggaaAGTTGCGCATTTGAAGCTGCACAAATTAatgcacaccgacgagaagccgttcagctgtgacctgtgcgattataaatgccgacaaatTTCAAACTTGAAGACTCACAAATCTTCGCCAATTTTTGAAACGTTGGACAAGCGAAAATACGAATGCCGCACGTGCGGTTGCAAATTTACAACGTCCGGCCACAGACGCAATCACACgttgatacacaccggcgagaagccgtttacCTGCGATTTATGCGACTACAGATGTCGCCAGGCCTCGCATTTAAAACTGCACGTGCTGAcgcacaccaacgagaagccgcGCATTTGTGGTTTCTGCGGTTACAAATGCCGCCAGGTCGGAAACTTGAGGCGACACATGCTGACGCATACCGTCGAGAAACCACATCGTTGTAATCTTTGCGACTACACGTGTCGGCACAGCTCGAGTCTAAAACGGCACAAGCTgaaacacaccggcgaaaaaCACGACAGACCTCCGAACGCACGCGAGTTCAGGTGCGAACTTTGCGAACATCTCAGCACGACCGCCGGCAATTTAAAGCTGCACATGCGCGTACAttccgacgagaaaccgttcaagtGTGACGTTTGTAAGTACGCGACTAGATGGTCGCAGCATTTGAAGAGGCACGCGCAGTCGCACGAGAAATGGCTGAGATGCAACATTTGCCAGTACACGTGTAAATTCGCGAAGGATTTAAAAGGGCATGTGGCGTCACATGCCGGCGAAAACCCCCTCTGA
Protein Sequence: MPFSCNVCEYKCRQIGHLRQHMLTHTDEKPFSCDLCDYKSRQISNLRRHKLKHTDDKPFSCDLCEYKCREVGAFKRHELTHTDVKPYACDLCDYKFRQFAHLKQHKLTHSGEKPYNCDLCDYKCRCIESLKTHKLMHTDEKPFSCDICEYKCRYIGNLRRHKLKHTNEKPFSCELCEYKCREIVALKKHELRHTDDKPYSCDQCDYKCRKVAHLKLHKLMHTDEKPFSCDLCDYKCRQISNLKTHKSSPIFETLDKRKYECRTCGCKFTTSGHRRNHTLIHTGEKPFTCDLCDYRCRQASHLKLHVLTHTNEKPRICGFCGYKCRQVGNLRRHMLTHTVEKPHRCNLCDYTCRHSSSLKRHKLKHTGEKHDRPPNAREFRCELCEHLSTTAGNLKLHMRVHSDEKPFKCDVCKYATRWSQHLKRHAQSHEKWLRCNICQYTCKFAKDLKGHVASHAGENPL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01258853;
90% Identity: iTF_01258853;
80% Identity: iTF_01258853;