Pjap025567.1
Basic Information
- Insect
- Popillia japonica
- Gene Symbol
- -
- Assembly
- GCA_004785975.1
- Location
- SMLS01021662.1:4268-5553[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.017 1.3e+02 3.5 0.2 17 38 102 123 97 134 0.70 2 5 0.0044 34 5.4 0.0 22 45 137 160 130 167 0.84 3 5 0.00028 2.2 9.3 0.1 22 46 165 189 160 192 0.90 4 5 2e-05 0.15 13.0 0.1 21 52 192 223 188 225 0.90 5 5 0.0012 9.5 7.2 0.0 21 48 220 247 218 249 0.90
Sequence Information
- Coding Sequence
- ATGGATGATAGAACACATGACAGTTTCAACAGTTTGGAACCTGATGTTATAATTACTGACGGGCACGTTTTCGATGATAAACTATCGATGGACAAAGATGATTTAGAAGAAAACAACCCCCTCCTGATAGGACCTGAAATCTCAATAATTCCAGTTCCGAGCAAACCGCCAGCGAAAATTCGAGTTAGAAATTTCCTAGAAGAAGAGCACAGACTCATCAGGCATCGAGAACGTTCCCCTAGAGGTAACGTACGCATAGTGAGTCCGGCTGAAATCGTAAAAGCGGAAATTAAATATTCCTATTCGAGAAGGAAATCTTTACCGCTAGAAAAATGCCCTATCTGCAAAAAATTCTTCAGGAGAATGAAGACCCACCTATTAAAACACGAAGAGCAGCAACGGGGTCCGGACGACCCCCTAACGTGTAAACTCTGCAAGAAGGTCTTTAACACCTACAGCAATTTGAGTATTCATATGAGAACGCACACCGGCGATAAGCCTTACATATGCGATATTTGCGACAAATCTTTCTCCCAATCCTGCAATTTAGTTAACCATCTCCGGATACACACCGGGGAGAGACCGTATAAATGTCCGCATTGCGATCGGGCTTTCACTCAATCAGGCAATCTTACCAATCACATACGCTTACATACGGACGAGAAGCCTTTTgtgtgtcatttttgtgacagGGCTTTCACGCAATCGGGTAACCTAAATTCTCACATTCGAAACAATCATAAGTTGGATGATTCgaggaattttattaatttccattaa
- Protein Sequence
- MDDRTHDSFNSLEPDVIITDGHVFDDKLSMDKDDLEENNPLLIGPEISIIPVPSKPPAKIRVRNFLEEEHRLIRHRERSPRGNVRIVSPAEIVKAEIKYSYSRRKSLPLEKCPICKKFFRRMKTHLLKHEEQQRGPDDPLTCKLCKKVFNTYSNLSIHMRTHTGDKPYICDICDKSFSQSCNLVNHLRIHTGERPYKCPHCDRAFTQSGNLTNHIRLHTDEKPFVCHFCDRAFTQSGNLNSHIRNNHKLDDSRNFINFH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01253062;
- 90% Identity
- iTF_01253062;
- 80% Identity
- iTF_01253062;