Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.09 1.9e+02 5.3 0.1 85 108 2 25 1 27 0.91

2 4 0.0077 16 8.7 0.1 77 108 26 57 24 59 0.89

3 4 2.1e-20 4.6e-17 65.2 0.0 7 99 117 211 112 224 0.84

4 4 2.1 4.4e+03 0.9 0.0 77 100 223 246 220 252 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.09	1.9e+02	5.3	0.1	85	108	2	25	1	27	0.91
2	4	0.0077	16	8.7	0.1	77	108	26	57	24	59	0.89
3	4	2.1e-20	4.6e-17	65.2	0.0	7	99	117	211	112	224	0.84
4	4	2.1	4.4e+03	0.9	0.0	77	100	223	246	220	252	0.83

Coding Sequence: atgGATGTTTATCAACTCGCTGAAGAATTTAAAATGACCAGGCTTGAATATCTATGCGTCCaatttttaaatacaacaattTGTCTAAATAACATCGTCGAAGCTTTAAAAAACGCGGACAAATTGAAGCTCGATTTTATCAAAGAACAATGCTTGAGGTTCATAGTGAAAGATACCAATTTTAATCACATTATTATGAGTTCGGAATTCGAAACGTTGGACAGCAGATTAATGGTGCAGATCATTCGCAGAAAGCAAATGCCGCCACCTAAGGCTGCACATGAAACCACTTTCGATTTGTCTAAAAACTCTCTGGAACACGATATGAAATATTTCCTTATGAGTACGGGGAAAGAGTTCTGCGATGTAGATCTCATTCTGGAAGAGCATGTTATTCCAGCTCACAAAGCTATATTGGTCGCTCGATCTGGATACTTTGAGGCAAGATTTAGGTCTTGTATGCCCAACGAGACTGATAAAAAAGTAAACATTAAAATCGGCGACTTAACTCCATCGAAAAAGTCATTCGACACTCTGCTACGTTACATTTATTATGGAGACACAAAAATGCCTCCGGAAGACTCACTTTATCTCTTCGCATCGGCCTCGTTCTTCAACTTTTCAAACATCCGCTTGCAGACGTTCTGCAAGCAGAATTTGGAGCGAAACGTAACACCAGAGACCGTTATCGAAGTACTTGAAGCGGCAGATAGAATTCAAGCTACTGACATGAAAAAATACGCTTTAGACTTGATCGCTCTTAATTTCACGAAAGTTGTGAAGCAACCGAGGTTTAAATTGTTGGACAAAGCGTTGATCTTGGATATATTGGATATATTGGCTGATTGCATGGGCAGTAACCTCATAACAGACCCATGA
Protein Sequence: MDVYQLAEEFKMTRLEYLCVQFLNTTICLNNIVEALKNADKLKLDFIKEQCLRFIVKDTNFNHIIMSSEFETLDSRLMVQIIRRKQMPPPKAAHETTFDLSKNSLEHDMKYFLMSTGKEFCDVDLILEEHVIPAHKAILVARSGYFEARFRSCMPNETDKKVNIKIGDLTPSKKSFDTLLRYIYYGDTKMPPEDSLYLFASASFFNFSNIRLQTFCKQNLERNVTPETVIEVLEAADRIQATDMKKYALDLIALNFTKVVKQPRFKLLDKALILDILDILADCMGSNLITDP

Sequence clustering based on sequence similarity using MMseqs2