Pter085231.1
Basic Information
- Insect
- Polydrusus tereticollis
- Gene Symbol
- dl_2
- Assembly
- GCA_963920685.1
- Location
- OY987331.1:25772229-25786471[-]
Transcription Factor Domain
- TF Family
- RHD
- Domain
- RHD domain
- PFAM
- PF00554
- TF Group
- Beta-Scaffold Factors
- Description
- Proteins containing the Rel homology domain (RHD) are eukaryotic transcription factors. The RHD is composed of two structural domains. This is the N-terminal DNA-binding domain that is similar to that found in P53. The C-terminal domain has an immunoglobulin-like fold (See PF16179) that functions as a dimerisation domain [1-2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.5e-30 2.2e-25 92.7 0.1 1 63 90 152 90 153 0.97
Sequence Information
- Coding Sequence
- ATGCATCGCTGTAAGAAACTAATgcttattttttctaatttatccAATACAGATAGTGCCAAAGATGTGCTGAAAGGTCCGTACGATGCTCGCCTGAGTGATGTTATTGAAGTTATCAAAGAAACAGACCCGGACTTCACAGAGCACAGCAGCAGTGCCCCGAAGCGCCGACAGGCGTCTCCAATGTTGAACGGAGGGGGACAGGTACCGATGCCCCCACAATCCACTGGGGGACACTCTGGGGCTTATAGAAGGCATTCGGCTGAAGTTAGGTTAATAGAACAACCTGCATCCAAAGCGCTCCGATTTCGATATGAGTGCGAAGGCCGGTCAGCAGGATCGATTCCTGGGGCGAGCAGTACGCCGGAAAACAAAACCTTCCCCGAAATACAAGTGGTGGGCTACCAAGGGAGAGCTGTAGTTGTAGTATCGTGTGTAACAAAGGATGAACCGTACCTGTAA
- Protein Sequence
- MHRCKKLMLIFSNLSNTDSAKDVLKGPYDARLSDVIEVIKETDPDFTEHSSSAPKRRQASPMLNGGGQVPMPPQSTGGHSGAYRRHSAEVRLIEQPASKALRFRYECEGRSAGSIPGASSTPENKTFPEIQVVGYQGRAVVVVSCVTKDEPYL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -