Ppte023974.1
Basic Information
- Insect
- Polydrusus pterygomalis
- Gene Symbol
- E2F1
- Assembly
- GCA_963969555.1
- Location
- OZ018376.1:149258118-149267414[+]
Transcription Factor Domain
- TF Family
- E2F
- Domain
- E2F_TDP domain
- PFAM
- PF02319
- TF Group
- Helix-turn-helix
- Description
- This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.7e-31 4.7e-27 95.6 0.2 2 65 113 176 112 176 0.98
Sequence Information
- Coding Sequence
- ATGCCAAAACCACCCGGAATCCGCCACGGCGAAAGCCCGTCGAGGGGCTACAGGACTATGACAGCGACATCACATACCCCAGACATGACAATCATAAAGGAAGAATACATCAAGCAAGAATTTACGCCTAGTCCGCACATGTTAGACCACGCTTACGGTGTGACACCAAGGAATCAAATGATGTCGCATACGCCACCTACAGCACCTTCAGTGAAAAGAAAACTAAACCTGGAAGCGCAGAACTTCAATGTCGTACCTTTTGTGCATAAACACGAGTTCAAAACGCCACAGCCCAAAAGACaaaaaaagcaatcgctacttCGAAAACCACGCTACGATACATCGCTAAGTTTACTGACGAAAAAGTTTTCGGAATTGTTGCAGAAGAGCCCCAATGGTGTAGTCGATCTAAATAAGGCGTCGGCCGATCTTAAAGTGCAAAAAAGACGGATTTATGATATAACGAATGTGTTAGAGGGGATAGGGTTGCTGgagaaaaaatcgaaaaataatatTCAGTGGAAGGGGGGCAAGGACAATACGGCTTTCTTTACGTTAaagaaaaagttgaaaatattgGAGGACCGGGAGAATCAGCTGGACAGGCAGTTGGAAATGGCGGAGAGGGAGCTGAGGAAGCTGGGAAACGACAAGTAA
- Protein Sequence
- MPKPPGIRHGESPSRGYRTMTATSHTPDMTIIKEEYIKQEFTPSPHMLDHAYGVTPRNQMMSHTPPTAPSVKRKLNLEAQNFNVVPFVHKHEFKTPQPKRQKKQSLLRKPRYDTSLSLLTKKFSELLQKSPNGVVDLNKASADLKVQKRRIYDITNVLEGIGLLEKKSKNNIQWKGGKDNTAFFTLKKKLKILEDRENQLDRQLEMAERELRKLGNDK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00845665;
- 90% Identity
- -
- 80% Identity
- -