Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 7.9 8.5e+03 -2.8 0.1 39 70 16 26 10 41 0.48

2 3 2.5e-10 2.7e-07 30.8 1.3 1 55 66 119 66 142 0.91

3 3 5.9 6.4e+03 -2.4 0.0 23 41 180 198 158 203 0.56

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	7.9	8.5e+03	-2.8	0.1	39	70	16	26	10	41	0.48
2	3	2.5e-10	2.7e-07	30.8	1.3	1	55	66	119	66	142	0.91
3	3	5.9	6.4e+03	-2.4	0.0	23	41	180	198	158	203	0.56

Coding Sequence: ATGTCCCGAGAAGAATCACTTTTCTACCGcggtaaaaaacaattttaccgAAAAGCTAAAGACAAAGCAATAAGCAAttatagaaaacaattatattttatgaaaaatgcgCCATTCATCAAATTCGGcaattttacagaaaatattgGATTAAAATTGGGATTGGTAGAATATAATCCAATAATAAAAACCACAAGAAAACCACCATTTTCTTTAAGACTTATAATTTACAGAGCATTTATAGATTTagataaatcagttttatcaaTATGGACCATCTATCaatggattaaaaaaaattatccataTTACGAACATGTTAATATTCACTGGTTATCGGCATTAAgagaacaattaataaaatattttttgccgTTTGAAGCATTTCAGACTTACGAATGGAAAATAAATCCAAAGTATGTATGTgcaattgaaaatgaaatgaacaGAGCACAATTTTATTGCACGGCACCTTCTTTAACATCTCTTCATTTGATTGATAGCAGCCTACAATTATCAGTACAACCGAAAAATGCTTATCCGAAACATCCTTGGGttcagtttattaaaaaaattaaacctgCCTATGAAAGCGACGATGAAAATGAGTATTAA
Protein Sequence: MSREESLFYRGKKQFYRKAKDKAISNYRKQLYFMKNAPFIKFGNFTENIGLKLGLVEYNPIIKTTRKPPFSLRLIIYRAFIDLDKSVLSIWTIYQWIKKNYPYYEHVNIHWLSALREQLIKYFLPFEAFQTYEWKINPKYVCAIENEMNRAQFYCTAPSLTSLHLIDSSLQLSVQPKNAYPKHPWVQFIKKIKPAYESDDENEY

Sequence clustering based on sequence similarity using MMseqs2