Basic Information

Gene Symbol
lolal
Assembly
GCA_000187915.1
Location
NW:170268-174176[-]

Transcription Factor Domain

TF Family
BTB
Domain
zf-C2H2|ZBTB
PFAM
PF00651
TF Group
Zinc-Coordinating Group
Description
The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 9.4e-33 1.9e-30 104.6 0.0 1 100 5 100 5 104 0.95

Sequence Information

Coding Sequence
ATGGTATCATCGTTCAAACATCTGCGAGATGAGAAAAGCTTCACGGATGTGACATTGGCTTGCGATGGTCAAACTTGCAAAGCGCATAAGATGGTTTTGTCTGCCTGTAGTCCTTATTTTAAATCCTTATTAGAGGAAAATCCGTCCAAACatccaattataattttaaaggacGTTGCATACAGTCATCTACAAGCTATTCTAGAATTTATGTATGCGGGTGAAGTAAATGTTTCACAAGATCAGCTGCCAGCATTTCTCAAAACAGCAGACCGGCTTAAAGTTAAAGGACTAGCTGAAGCTCCTGGTGCCATTAAAAGAGAAGGTTAA
Protein Sequence
MVSSFKHLRDEKSFTDVTLACDGQTCKAHKMVLSACSPYFKSLLEENPSKHPIIILKDVAYSHLQAILEFMYAGEVNVSQDQLPAFLKTADRLKVKGLAEAPGAIKREG

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00139785;
90% Identity
iTF_00808442;
80% Identity
iTF_01254890; iTF_00230754; iTF_01067682; iTF_01070434; iTF_01424450; iTF_00118083; iTF_00218499; iTF_00223267; iTF_00762627; iTF_00963267; iTF_00215780; iTF_01420996; iTF_00141285; iTF_00225989; iTF_00625573; iTF_01067013; iTF_00866087; iTF_00087272; iTF_00141896; iTF_01071080; iTF_00966089; iTF_00228042; iTF_00228747; iTF_01065643; iTF_01069739; iTF_00085484; iTF_00864716; iTF_00226669; iTF_00961901; iTF_00684846; iTF_00088911; iTF_00220655; iTF_00223951; iTF_00229423; iTF_01068367; iTF_00360976; iTF_00863344; iTF_01417776; iTF_00224625; iTF_00227347; iTF_00216468; iTF_00140661; iTF_00219189; iTF_00233301; iTF_00866773; iTF_00088118; iTF_00230102; iTF_00761046; iTF_01069046; iTF_01420342; iTF_00221335; iTF_00232055; iTF_00962583; iTF_00982359; iTF_01419063; iTF_00215096; iTF_00086393; iTF_00860473; iTF_01122521; iTF_00217146; iTF_01419706; iTF_00217819; iTF_00862651; iTF_00983035; iTF_01066331; iTF_00214461; iTF_00231389; iTF_01123133; iTF_00084638; iTF_00219870; iTF_00232670; iTF_00360286; iTF_00861246; iTF_00225311; iTF_00142528; iTF_00676096; iTF_01169248; iTF_00879815; iTF_00883121; iTF_00881372; iTF_00882236; iTF_00880573; iTF_01110220; iTF_01112718; iTF_01113518; iTF_01111059; iTF_01111864; iTF_00181383; iTF_00015451; iTF_00255169; iTF_00464065; iTF_01216865; iTF_01395201; iTF_01423009; iTF_00182690; iTF_00252162; iTF_00287330; iTF_01477698; iTF_00730147; iTF_01381411; iTF_00126820; iTF_00128324; iTF_01199492; iTF_01468932; iTF_01493668; iTF_00253669; iTF_00305701; iTF_00714469; iTF_00868197; iTF_01087301; iTF_00080198; iTF_00089670; iTF_01198758; iTF_01422310; iTF_01474790; iTF_00691175; iTF_01409287; iTF_01423751; iTF_00016104; iTF_00668712; iTF_00729416; iTF_00730856; iTF_00867528; iTF_01393640; iTF_01421640; iTF_01492968; iTF_01523464; iTF_01036297; iTF_01524105; iTF_00252906; iTF_00280042; iTF_00309578; iTF_00393674; iTF_00756746; iTF_01273866; iTF_01354698; iTF_01466314; iTF_01474026; iTF_01514890; iTF_00011243; iTF_00460907; iTF_01261899; iTF_01392875; iTF_01520363; iTF_00452652; iTF_00769772; iTF_01476332; iTF_01405869; iTF_01465389; iTF_01513549; iTF_00143950; iTF_00280654; iTF_00708590; iTF_00417679; iTF_00739151; iTF_00046256; iTF_00452016; iTF_01394448; iTF_01487120; iTF_01498288; iTF_00016753; iTF_00200881; iTF_00298417; iTF_00385649; iTF_01090065; iTF_01229105; iTF_01389553; iTF_01538065; iTF_00047090; iTF_00048050; iTF_00391410; iTF_00633714; iTF_00676850; iTF_00693010; iTF_01274578; iTF_01392114; iTF_00064563; iTF_00168595; iTF_00291635; iTF_00765747; iTF_01408371; iTF_01514227; iTF_00014804; iTF_00294580; iTF_00306356; iTF_00738452; iTF_00109909; iTF_00127573; iTF_00296117; iTF_00297653; iTF_00707989; iTF_00712949; iTF_01035509; iTF_01099317; iTF_01273173; iTF_01390421; iTF_01473269; iTF_01488789; iTF_00438838; iTF_00728726; iTF_00126071; iTF_00295351; iTF_01407479; iTF_00438168; iTF_00692024; iTF_00770456; iTF_01213400; iTF_01355512; iTF_01468056; iTF_00292345; iTF_00868953; iTF_01130906; iTF_01391290; iTF_00980251; iTF_00254428; iTF_00293820; iTF_00296892; iTF_01255772; iTF_01512252; iTF_00182045; iTF_00264381; iTF_00351197; iTF_00885245; iTF_01015933; iTF_01219165; iTF_01467197; iTF_01512893; iTF_00293054; iTF_00690270; iTF_01475550; iTF_01120287; iTF_01190463; iTF_00286432; iTF_01469760; iTF_01418417; iTF_00873863; iTF_00734014; iTF_00983667; iTF_00221976;