Phis040619.1
Basic Information
- Insect
- Pogonocherus hispidulus
- Gene Symbol
- Sub1
- Assembly
- GCA_963924545.1
- Location
- OZ004698.1:56719892-56720291[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.6 3.4e+04 -4.0 1.2 32 37 4 9 3 9 0.82 2 2 3.7e-29 2.1e-24 86.4 1.6 1 51 48 98 48 99 0.98
Sequence Information
- Coding Sequence
- ATGCCGAAACACAAGCCTAGCAAGAAAGATGAAAGCTCGAACTCCGATTCAGACTCAGGCCCGGACGATAGAGGCCCGATAAAGAAGCCGAAGTCAGACACTAAACCAAAGTCTAGCAAATCTAGTGAAGAGGAGAACAGCTGGGAGTTGGGAAAGAACCGATTTGTTAAATTGTCAGAGTTCAAAGGAAAATGGTACGTTAACATCAGGGAATTTTATAATGCTGATGGAGAGCTGAAGCCAGGGAAGAAGGGCATCATGCTGACCATGGAGCAATGGCAGAAGTTCAAGAGTAATATTGATGATATAGACGAAGCTATAAAGAAGAACGTTTAG
- Protein Sequence
- MPKHKPSKKDESSNSDSDSGPDDRGPIKKPKSDTKPKSSKSSEEENSWELGKNRFVKLSEFKGKWYVNIREFYNADGELKPGKKGIMLTMEQWQKFKSNIDDIDEAIKKNV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01014500; iTF_00110568; iTF_00886033; iTF_00722055; iTF_01369422; iTF_01290003;
- 90% Identity
- -
- 80% Identity
- -