Basic Information

Transcription Factor Domain

TF Family: E2F
Domain: E2F_TDP domain
PFAM: PF02319
TF Group: Helix-turn-helix
Description: This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 8.1e-24 3.9e-20 71.7 0.0 1 65 47 118 47 118 0.90

2 2 0.0096 46 4.2 0.0 1 16 148 163 148 173 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	8.1e-24	3.9e-20	71.7	0.0	1	65	47	118	47	118	0.90
2	2	0.0096	46	4.2	0.0	1	16	148	163	148	173	0.84

Coding Sequence: ATGCGCGACGACTACGGTTTCGGCGCGAACGCGATGCACACGCCGAAGCGCTCCGCCCTCGCCGAGGTGACCAACGTGTCGCCCACGGCCAACCTGAAGCTGCTGACGAACGTGGCGCTGCAGTGTCCCTACCAGCGCAAGGAGAAGTCGCTGCAGATCCTCTGCGATCGCTTCCTGGAGCTGTACCCGCTGAGGGGACGCGGCTTCGACGGCGGCCGTCGCCCCGAGATCCACCTGGACGCGACGGCCCAGCGGCTGGGCGTCGAGAAGCGCCGCATCTACGACATCATCAACATCTTGGAGGCGCTGCAGTGCGTGGCCCACCGCCGCAAGAACACGTACGCTTGGCACGGAGGCTCCGACATGGAGCGCTACATCGCCTCGCTCAAGCGGCAGGGCGAGTCCGCCGGCAAGCGCTCCTCTCGCTCCACCGCTCCGCCCAAGCGCCGCTCGCTCGGCAACCTGGCGCAGAGGTTCCTCGTCATGTTCCTCGTCCGCCCGCCGGTAATATTCACTTTTCATTAA
Protein Sequence: MRDDYGFGANAMHTPKRSALAEVTNVSPTANLKLLTNVALQCPYQRKEKSLQILCDRFLELYPLRGRGFDGGRRPEIHLDATAQRLGVEKRRIYDIINILEALQCVAHRRKNTYAWHGGSDMERYIASLKRQGESAGKRSSRSTAPPKRRSLGNLAQRFLVMFLVRPPVIFTFH

Sequence clustering based on sequence similarity using MMseqs2