Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.0007 0.41 12.6 0.0 3 28 170 194 168 195 0.86

2 3 9.5e-13 5.6e-10 41.1 0.0 55 108 199 252 194 254 0.92

3 3 0.064 38 6.2 0.1 78 107 254 283 249 286 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.0007	0.41	12.6	0.0	3	28	170	194	168	195	0.86
2	3	9.5e-13	5.6e-10	41.1	0.0	55	108	199	252	194	254	0.92
3	3	0.064	38	6.2	0.1	78	107	254	283	249	286	0.83

Coding Sequence: ATGGATGATAATATAGAATATAATCATTTACTTGATGGTTCGACGGAAGTTACGTGGACGATCAAAAATATCAGTTCCCGTTTAGGAAGTAAACCCATCACATCCCCTATTGGTTCGGATTTTTGGATACAAAAAGAGACGTGGCGTTTAGATTTACAGATGGTATATCATTGGACTGGTTTAGTCGATTACCTAATATTGTTTCTCATCCCTACTCTTCCAACAAATACTATTACAGTCACTGGTAGTTTTTTCATTCAGAAACCGGACGGTTCGTGTAGCATGAAACCCTTTTATGTATATTTTAACAACAGGGCTGTGAAAGGAAAAGCCACGTTAATCAACTATAATACTTATATAGTTGAACCAATCAACAAAATCGTGGAAAATGACACTTTGACTATCGCTTGTAAATTCAAAGTTTCGTTGGGAGAAATTAAAAGTGATAACAACGTTTTTGATATTGACACTAATAAGTTTGTGCAGGATTTGTCACAAGATATGAGTCAAATGCTGACAGACGAAAGTTTGAGTGACGTTTGTCTGGTTGCGGGGAACGAAAAGTTTCCCGTTCACAGGATATCCTCGCGGCCAGAAATCCAAGACGTCGAACCTGAAGTAATGCGAGCGGTAATTAGTTTTATGTACACCGGACAGGTCGATGAACTTGAGGACAAAGCCATCGAAATTCTAAAAGCTGCGGACAAATACCAATTGGAAGGATTAAAAACATTATGCGGAACAACAATCGCAAAAAGCGTTTCTGTAGAAAATGTCAAGGAGATTTTGCAAATTGCTGATCTTTACAACAGTCAGGAACTTAAAAATTTCGTCATTTATTTTATAAAACTGAACCTGAAGGAAATAATGAATAAATCTGCTTTGGAGAACTTTAAAGGAACGAAACTAATCGAAATCATCGAATCTTTAAATGATTAA
Protein Sequence: MDDNIEYNHLLDGSTEVTWTIKNISSRLGSKPITSPIGSDFWIQKETWRLDLQMVYHWTGLVDYLILFLIPTLPTNTITVTGSFFIQKPDGSCSMKPFYVYFNNRAVKGKATLINYNTYIVEPINKIVENDTLTIACKFKVSLGEIKSDNNVFDIDTNKFVQDLSQDMSQMLTDESLSDVCLVAGNEKFPVHRISSRPEIQDVEPEVMRAVISFMYTGQVDELEDKAIEILKAADKYQLEGLKTLCGTTIAKSVSVENVKEILQIADLYNSQELKNFVIYFIKLNLKEIMNKSALENFKGTKLIEIIESLND

Sequence clustering based on sequence similarity using MMseqs2