Basic Information

Gene Symbol
-
Assembly
GCA_949748235.1
Location
OX456489.1:2950596-2952568[+]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 4 0.0059 8.5 6.5 0.0 19 48 70 99 64 103 0.86
2 4 5.2e-05 0.075 13.1 0.0 21 51 100 130 97 131 0.88
3 4 0.00094 1.3 9.1 0.0 21 46 128 153 125 158 0.91
4 4 0.65 9.3e+02 0.0 0.3 26 43 161 178 155 185 0.79

Sequence Information

Coding Sequence
ATGGATGAGGACAATGTTCCATTGGATTTGAGTATATCTAGAAAAGAACCATCAAATTCAATCGAGGCACCACTTCCAGATGTCTTGCCAAATCAAGAAGATCACAAAAAAATCGAATCAGTTGATCCTGCCAATTTTGATATTTCGCAGTCCTTACATAGTGAAATTGTAACAGAAAGAAAACAGATAAATCCTGAAAATGAAGCAGGACAAggtgaaaaaccatataaatgtgaattttgcgGTGTAGCATTTCGTCATCGACAACATTTGAATGAGCATGTAAaaattcacactgatgaaaaaccatataaatgtgAAATTTGCGGTGCAGCATTTCGTCAACGTGTAACTTTGAATGACCATTTAAAtattcacactggTGAAAAACCACACAAATGTGAAATTTGCGGTGCAGCATTTAATGCACCATCGAATTTGAAAAATCATGTGCCATtacacactgGGAAATGGCGATATACATGTCAAATATGCGGTTATGGATGTAATCATCCATCGACATTAAAGAGACATTCAAAAACTCACACTGGAAATGAATCACCTAAAGCGGGACCATCTGGATGttcatcaaaataa
Protein Sequence
MDEDNVPLDLSISRKEPSNSIEAPLPDVLPNQEDHKKIESVDPANFDISQSLHSEIVTERKQINPENEAGQGEKPYKCEFCGVAFRHRQHLNEHVKIHTDEKPYKCEICGAAFRQRVTLNDHLNIHTGEKPHKCEICGAAFNAPSNLKNHVPLHTGKWRYTCQICGYGCNHPSTLKRHSKTHTGNESPKAGPSGCSSK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01216287; iTF_01216288;
90% Identity
iTF_01216287; iTF_01216288;
80% Identity
iTF_01216287;