Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00039 0.56 10.3 0.1 22 48 73 99 68 103 0.81

2 5 0.0067 9.7 6.4 0.1 21 52 100 131 97 132 0.88

3 5 0.049 70 3.6 0.2 21 46 128 153 125 155 0.89

4 5 8.1e-05 0.12 12.5 0.1 21 46 156 181 153 186 0.91

5 5 0.3 4.3e+02 1.1 0.0 26 43 189 206 184 210 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00039	0.56	10.3	0.1	22	48	73	99	68	103	0.81
2	5	0.0067	9.7	6.4	0.1	21	52	100	131	97	132	0.88
3	5	0.049	70	3.6	0.2	21	46	128	153	125	155	0.89
4	5	8.1e-05	0.12	12.5	0.1	21	46	156	181	153	186	0.91
5	5	0.3	4.3e+02	1.1	0.0	26	43	189	206	184	210	0.87

Coding Sequence: ATGGATGAGGACAATGTTTCATTGGATTTGAGTATATCTAGAAAAGAACCATCAAATTCAATCGAGGAACCACTTCCAGATGCCTTGCCAAATCAAGAAGATGACGAAAAGATCGAATCAGTTGATCCTGCCAATTTTGATATTTCGCAGTTTTTACATTGTGAAATTGTAACAGaagaaaaacagataaatcCTGAAGTTGAAGCAGGACAAGGAAAAAAACGATTTGCATGTCCAAAATGCCAACAGTCATTTCGACAGAAAAGTAACTTGAATACACATCTGATGATCCACACTGgtgaaaaaccatataaatgtgaattttgcgATAAAACATTTCGTCGACAATCACATTTGAAAGAGCATTTAAAAATTCACAgtgatgAAAAACCATGtaaatgtgaattttgcgGTGTAGCATTTCGTCATCGACAAACTTTGAATAACCATGTAAaaattcacactggtgaaaaaccaCACAAATGTGAAATTTGCGGTGCAGCATTTCGTCAACGAGCACATTTGAATGACCATTTGCAAATTCACACAgGGAAATGGCGACATACATGTCAAATATGCGGTTCTGGATTTAATCATCCATCAAGTTTAAAAAGACATTCAAAAACTCACACtgATCTCGAATCTAATTCTACTTTAACAAATAATTCAGGAAATGAATCACCTAAAGCGGGGCCATCTGGATGttcatcaaaataa
Protein Sequence: MDEDNVSLDLSISRKEPSNSIEEPLPDALPNQEDDEKIESVDPANFDISQFLHCEIVTEEKQINPEVEAGQGKKRFACPKCQQSFRQKSNLNTHLMIHTGEKPYKCEFCDKTFRRQSHLKEHLKIHSDEKPCKCEFCGVAFRHRQTLNNHVKIHTGEKPHKCEICGAAFRQRAHLNDHLQIHTGKWRHTCQICGSGFNHPSSLKRHSKTHTDLESNSTLTNNSGNESPKAGPSGCSSK

Sequence clustering based on sequence similarity using MMseqs2