Pros002311.1
Basic Information
- Insect
- Platycheirus rosarum
- Gene Symbol
- bun_1
- Assembly
- GCA_963971375.1
- Location
- OZ020507.1:28045588-28054332[-]
Transcription Factor Domain
- TF Family
- TSC22
- Domain
- TSC22 domain
- PFAM
- PF01166
- TF Group
- Basic Domians group
- Description
- These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Drosophila protein bunched [1] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 2.7e-29 7.6e-25 88.4 6.9 2 56 34 88 33 89 0.97 2 4 0.42 1.2e+04 -1.9 0.3 46 55 108 117 99 121 0.47 3 4 2 5.6e+04 -4.5 3.0 45 52 123 130 109 135 0.52 4 4 2 5.6e+04 -4.9 4.1 44 44 146 146 129 162 0.57
Sequence Information
- Coding Sequence
- ATGGGCACCATGTCACTTCGTCAACCCGAAAACTGGCTCTATGAGATCTGGCAAAAGGGACAAGATAGTCCTTGCTATGTTATGGTCCCAAATGCAAAAGATTTGGTCAAATCCCATCTTATGATAGCAGTTCGAGAAGAAGTCGAAGtgctaaaagaaaaaatatccgAATTAATGGATAAAATCAATCAACTCGAGGTGGAGAATACTATTCTCAAGGCAAATATGTCGCAGGAAACACTTCATCAATTGCAAATACAAGCTCAATTGCAAATTGCTGGCAGCGGTGGTACTAACAATATGATTACTCAGGCACCACCACCAaatccacaacaacaacaacaacaacaacagggcCAACAACCCCCACCccagcaacaacagcagcaaccccAACAACAGGCACCACcgccacaacaacaacagcagcagcaagcTGCAACTCAACAACCCCAACAAGCTccgcagcagcagcaacaacaacaagctCCTCCAACCAATCCTACAAACACCACTAACGGTCCATTGTCATAA
- Protein Sequence
- MGTMSLRQPENWLYEIWQKGQDSPCYVMVPNAKDLVKSHLMIAVREEVEVLKEKISELMDKINQLEVENTILKANMSQETLHQLQIQAQLQIAGSGGTNNMITQAPPPNPQQQQQQQQGQQPPPQQQQQQPQQQAPPPQQQQQQQAATQQPQQAPQQQQQQQAPPTNPTNTTNGPLS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -