Basic Information

Transcription Factor Domain

TF Family: TSC22
Domain: TSC22 domain
PFAM: PF01166
TF Group: Basic Domians group
Description: These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Drosophila protein bunched [1] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0063 6.4e+02 4.0 0.0 19 34 34 49 21 57 0.58

2 6 0.00077 77 6.9 0.0 15 42 44 71 38 80 0.60

3 6 0.0028 2.8e+02 5.1 0.0 12 35 69 92 65 102 0.76

4 6 0.0011 1.1e+02 6.4 0.0 16 30 101 115 86 134 0.53

5 6 0.00096 97 6.6 0.0 13 35 133 155 128 171 0.63

6 6 0.00028 28 8.3 0.0 12 46 160 194 157 220 0.79

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0063	6.4e+02	4.0	19	34	34	49	21	57	0.58
2	6	0.00077	77	6.9	15	42	44	71	38	80	0.60
3	6	0.0028	2.8e+02	5.1	12	35	69	92	65	102	0.76
4	6	0.0011	1.1e+02	6.4	16	30	101	115	86	134	0.53
5	6	0.00096	97	6.6	13	35	133	155	128	171	0.63
6	6	0.00028	28	8.3	12	46	160	194	157	220	0.79

Coding Sequence: ATGTACGATCCACCATCTATGATCTACGTTCTCCGATCTATAATCTACGATCCACGATCCACGATCTACGCTCTACGATCTTCGATCAACGACCACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACAATCTACGATCTACGATCTACGATCTACTATCTACGATCTACGATCTACTATCTACGATCTACTATCTACGATCTACTATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACTATCAACGATCTACGATCAACGATCTACGATCAACGATCTACGATCTACGATCTACAATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACGATCTACATTCTACGATCTACTCGCAACTCGCAACTCGCTATTCGCAACTCGCTACTCGCATTTGCATTTTGTAATTCGCAACTGGCAGCACGCAATTCGCAGTTAcaataa
Protein Sequence: MYDPPSMIYVLRSIIYDPRSTIYALRSSINDHDLRSTIYDLRSTIYDLRSTIYDLRSTIYDLRSTIYYLRSTIYYLRSTIYDLLSTIYDLRSTIYDLRSTIYDLRSTIYDLRSTIYDLRSTIYDLRSTIYYQRSTINDLRSTIYDLRSTIYDLRSTIYDLRSTIYDLRSTIYDLRSTIYDLRSTIYILRSTRNSQLAIRNSLLAFAFCNSQLAARNSQLQ

Sequence clustering based on sequence similarity using MMseqs2