Pruf000215.1
Basic Information
- Insect
- Physocephala rufipes
- Gene Symbol
- -
- Assembly
- GCA_963966595.1
- Location
- CAWZZZ010000040.1:62715-63284[-]
Transcription Factor Domain
- TF Family
- TSC22
- Domain
- TSC22 domain
- PFAM
- PF01166
- TF Group
- Basic Domians group
- Description
- These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Drosophila protein bunched [1] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0014 3 8.5 0.6 32 54 72 94 59 95 0.84 2 5 0.00081 1.8 9.2 0.5 31 55 90 114 87 116 0.87 3 5 0.00081 1.8 9.2 0.5 31 55 109 133 106 135 0.87 4 5 0.00034 0.74 10.4 0.5 31 53 128 149 124 153 0.78 5 5 0.0026 5.7 7.6 1.0 19 47 137 166 136 175 0.81
Sequence Information
- Coding Sequence
- atgAGCGTTGACAAGTTCGGTCGTTATTCTCAGCAGGgggaaaaccaaattaaattgaaaagaaatattctaagTGCTTTAGGTTTCAACTTGGATTatgataagaatttaaatctcCATAAAAAGCGATTAAAAAACGTTGGATCACCTAAAGAGGAAAGTGATGCCGTAACAAAGATATTTGTTGCTGAAAGTATAAATcagattgctttaaaaattcaacaagaaaactcattgctaaaggaaaatatatataaagatatttatacaaaaattcaacaagaaaactcattgctaaaggaaaatatatataaagatatttatacaaaaattcaacaagaaaactcattgctaaaggaaaatatatataaagatatttatacaaaaattcaacaagaaaactcattgctaaaggaaaacattaacaaagatATTCAACAGTTTCAAACAAGTTTACGTGCGGAAAACTCATTGTTAAAGGAAACCATTATTAGAGATATTCAAGAGCTACAATCATATGTTAAAGGTCTACAAGTCACTTACTACACAGTGAAcgctgaaaataaataa
- Protein Sequence
- MSVDKFGRYSQQGENQIKLKRNILSALGFNLDYDKNLNLHKKRLKNVGSPKEESDAVTKIFVAESINQIALKIQQENSLLKENIYKDIYTKIQQENSLLKENIYKDIYTKIQQENSLLKENIYKDIYTKIQQENSLLKENINKDIQQFQTSLRAENSLLKETIIRDIQELQSYVKGLQVTYYTVNAENK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01200673;
- 90% Identity
- iTF_01200673;
- 80% Identity
- -