Basic Information

Transcription Factor Domain

TF Family: TSC22
Domain: TSC22 domain
PFAM: PF01166
TF Group: Basic Domians group
Description: These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Drosophila protein bunched [1] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0015 3.2 8.4 1.0 32 54 72 94 59 96 0.85

2 5 0.0014 3.1 8.4 0.2 31 53 90 112 85 113 0.84

3 5 0.00077 1.7 9.3 0.6 31 55 109 133 105 135 0.87

4 5 0.00034 0.73 10.4 0.5 31 53 128 149 124 153 0.78

5 5 0.0019 4.1 8.0 0.9 19 47 137 166 136 175 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0015	3.2	8.4	1.0	32	54	72	94	59	96	0.85
2	5	0.0014	3.1	8.4	0.2	31	53	90	112	85	113	0.84
3	5	0.00077	1.7	9.3	0.6	31	55	109	133	105	135	0.87
4	5	0.00034	0.73	10.4	0.5	31	53	128	149	124	153	0.78
5	5	0.0019	4.1	8.0	0.9	19	47	137	166	136	175	0.81

Coding Sequence: atgAGCGTTGACAAGTTCGGTCGTTATTCTCAGCAGGgggaaaaccaaattaaattgaaaagaaatattctaagTGCTTTAGGTTTCAACTTGGATTatgataagaatttaaatctcCATAAAAAGCGATTAAAAAACGTTGGATCACCTAAAGAGGAAAGTGATGCCGTAACAAAGATATTTGTTGCTGAAAGTATAAATcagattgctttaaaaattcaacaagaaaactcattgctaaaggaaaatatatataaagatatttatacaaaaattcaacaagaaaactcattgctaaaggaaaatatatataaagatatttatacaaaaattcaacaagaaaactcattgctaaaggaaaatatatataaagatatttatacaaaaattcaacaagaaaactcattgctaaaggaaaacattaacaaagatATTCAACAGTTTCAAACAAGTTTACGTGCGGAAAACTCATTGTTAAAGGAAACCATTATTAAAGATATTCAAGAGCTACAATCATATGTTAAAGGTCTACAAGTCACTTACTACACAGTGAAcgctgaaaataaataa
Protein Sequence: MSVDKFGRYSQQGENQIKLKRNILSALGFNLDYDKNLNLHKKRLKNVGSPKEESDAVTKIFVAESINQIALKIQQENSLLKENIYKDIYTKIQQENSLLKENIYKDIYTKIQQENSLLKENIYKDIYTKIQQENSLLKENINKDIQQFQTSLRAENSLLKETIIKDIQELQSYVKGLQVTYYTVNAENK

Sequence clustering based on sequence similarity using MMseqs2