Preg009233.1
Basic Information
- Insect
- Phormia regina
- Gene Symbol
- -
- Assembly
- GCA_001735585.1
- Location
- MINJ01167258.1:6474-11041[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.002 15 6.8 0.0 26 52 21 47 14 49 0.90 2 4 5.9e-08 0.00043 21.3 0.1 22 46 51 75 44 79 0.86 3 4 0.019 1.4e+02 3.7 0.1 19 33 78 92 74 99 0.85 4 4 1.4 1e+04 -2.3 0.0 27 44 100 117 91 125 0.63
Sequence Information
- Coding Sequence
- tttCCCAGCAAAACTAAACTCACATCTCATCTGCCCGTCCACAGTACCATTTGCACTTGTATGTGCGATATTTGTGGCAATACATTCAAAAGTAAATTTACGCTTAAAAAACACATCGAATATCAACATTCGGGAAATCCACGAAAGGATAAAGAACCCCAACAATGTCCCATTTGTTATAAGGTTTTAAGAGGTCACAAGGGTCTTAGAGCTCACATGAGTAATATACACGCTGAAAGTGAACAGGAACATCGTTGCAAAATTTGTAATCATGTATCGACTACAGCTAAAGTGATTTGCGATAAATGTGGTAAAACATTTAGAGATAAATCACGTTTGAAATTACATCACAGACATGATCATTCGAATGAACCGAAACCTGAAAAAATACCACAACAATGTCAATACTGTAATAAATGGGCCGAATGGATCGCTGATCGTACAAAACCacctaaagaaaaatattcaagaaattaa
- Protein Sequence
- FPSKTKLTSHLPVHSTICTCMCDICGNTFKSKFTLKKHIEYQHSGNPRKDKEPQQCPICYKVLRGHKGLRAHMSNIHAESEQEHRCKICNHVSTTAKVICDKCGKTFRDKSRLKLHHRHDHSNEPKPEKIPQQCQYCNKWAEWIADRTKPPKEKYSRN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01194850;
- 90% Identity
- iTF_01194850;
- 80% Identity
- iTF_01194850;