Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 2.1 3e+03 -0.8 0.0 20 48 41 69 36 71 0.74

2 3 5.4 7.7e+03 -2.1 0.1 37 49 91 103 87 104 0.72

3 3 3.9e-07 0.00056 20.8 0.0 1 33 223 253 223 253 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	2.1	3e+03	-0.8	0.0	20	48	41	69	36	71	0.74
2	3	5.4	7.7e+03	-2.1	0.1	37	49	91	103	87	104	0.72
3	3	3.9e-07	0.00056	20.8	0.0	1	33	223	253	223	253	0.93

Coding Sequence: atgattGTAAATTCAACGATGAGCCATTCGCAAATGGATCCCCATCAGTGCGaaaatttttaccttaaaagaaAGTTGGACAACTCGGATGTGGTCGATTGCAATGCATCCTTTGTTCAAGCAAAAAAGCGGCACattcaaaacatttgcaaTAGTTTTGATGATAACTGTGATGTgcaatataatattaataataatggatTTACCAATGATTGTCCTCAAATCGAATTTCTAACATATGACAACAATTTAACGCCGGTCCAAACGACAGTTTACTGCAACGATCAATTCGAAACGACCTGGCAAAATGCAGATCTTCTCGAATTGGATCACAGATACAATTCAGGTAATAATACCACTATCGAAAAACACCAGCAACTAACTCCCCCCCGGGCTAATTCAAATTCATCACaaaccGACTCTGATTTCGAAGACAAGAACCTGTCTtggctttttaatttcaaattggaGGAATTGCCACATTTATCCCCGGAGGTTAGTCGCTCGAACGCATCATCGTCGGCAGTTAATAAATCTTGTAGAACAGTGCAATCGAAAACCGGGAAAAAAGTCGATGAATTGATCATGGAAATAACTTCGGAGATTGAAGAAAGCGATATGCTCGTTGGGGAAAATGTTATTGTGGAAAGCACTCCTAAAATgcCAAAAAAGCCGCCATTCACATATACAGAGCTTATAGAATACGCCCTGGAGGACAAGGGGGAGCTGACCGTTTCAGGGATATACCAGTGGATATCGTAA
Protein Sequence: MIVNSTMSHSQMDPHQCENFYLKRKLDNSDVVDCNASFVQAKKRHIQNICNSFDDNCDVQYNINNNGFTNDCPQIEFLTYDNNLTPVQTTVYCNDQFETTWQNADLLELDHRYNSGNNTTIEKHQQLTPPRANSNSSQTDSDFEDKNLSWLFNFKLEELPHLSPEVSRSNASSSAVNKSCRTVQSKTGKKVDELIMEITSEIEESDMLVGENVIVESTPKMPKKPPFTYTELIEYALEDKGELTVSGIYQWIS

Sequence clustering based on sequence similarity using MMseqs2