Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 8.9 5.6e+03 -1.0 0.0 74 107 100 134 74 137 0.73

2 3 5.2e-22 3.3e-19 70.6 0.3 11 109 189 287 180 288 0.91

3 3 4.9 3.1e+03 -0.1 0.0 78 107 288 317 286 320 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	8.9	5.6e+03	-1.0	0.0	74	107	100	134	74	137	0.73
2	3	5.2e-22	3.3e-19	70.6	0.3	11	109	189	287	180	288	0.91
3	3	4.9	3.1e+03	-0.1	0.0	78	107	288	317	286	320	0.82

Coding Sequence: ATGTACGAAGCGGTAGATGATGACTTTGCTCCCCAGAACGTCTTGGACATACAAGATCCTGCGGTGGTGTACGGCCATCGGGTCTGCCAGACACAAGACGTTAAATGGCTCTGCCTCGATAAGATTTACCAGAAGCTGAACCGGCCAAATTTTTATGACATAGGCGGTACATACCTGCAAGATGTAGCAGACCATTGGTTCTCGTATAAAACCGAACAGGTTTGCTCTATATACTTATTGCATTTATTCATCTGCAATCATGATGCAAATTCTTTCGACATCTCTGTTAGTTTCGGGAGTACTTTAAAATTCGATAAAAAATCAGATATAGCATACTTACCATCGACTTTGAAGGAATACCAATTTAAATCGCTTCCGGAACTCTCCCATTCCTATATTACTACATATAGTTTTAGCGAACTTGATGCTAAAAGTCTGGAAAATAAAATGCTGTACATTGGGGTATCCCTCTCCTCCAATAAAGCAGAGAGCATTAGTCATGATATTATTGATAATATTAAGCTGAAACATGACTGCAGTGCTCTTCTGACTGACCCGATTGGTTCAGATTTTACTATAGAGTCTGCAGATGGAGTAAAGTTTCAAGTTCACAAAGTTATTCTCGCAGCACACAGTGAGGTTTTCAAAGCTATGTTTAAGGAAGAGACTGCAGAGAGTCAAAATGGTTATGTCATGTTAATGGATGTCAATGAAGATGATCTTCGATTTATGCTTGAGTTTCTCTACTCGGGGTCTATTAAAGATATTGAGAATGCAAACTTCCTAAATTTACTTATGTTAGGAGACAGGTACGACCTTAAAGGTCTCTGTGAAATATCTCAGCATGCTTTGGTAGAGCAACTAAACAAGGAGAATGCTCTAGATATTCTTATTGTTGCTGATATGCATGATTCTGATTACCTTAAATCTGAGACactaaaatttatcaaaatgaaTTCAGACATTCTAAAATCTAGCACCTTTAAGGAGATTAAAAATGCTGATCTTGTTAGGCAACTGTGTATATATTTGGTgtcttaa
Protein Sequence: MYEAVDDDFAPQNVLDIQDPAVVYGHRVCQTQDVKWLCLDKIYQKLNRPNFYDIGGTYLQDVADHWFSYKTEQVCSIYLLHLFICNHDANSFDISVSFGSTLKFDKKSDIAYLPSTLKEYQFKSLPELSHSYITTYSFSELDAKSLENKMLYIGVSLSSNKAESISHDIIDNIKLKHDCSALLTDPIGSDFTIESADGVKFQVHKVILAAHSEVFKAMFKEETAESQNGYVMLMDVNEDDLRFMLEFLYSGSIKDIENANFLNLLMLGDRYDLKGLCEISQHALVEQLNKENALDILIVADMHDSDYLKSETLKFIKMNSDILKSSTFKEIKNADLVRQLCIYLVS*

Sequence clustering based on sequence similarity using MMseqs2