Pace003544.1
Basic Information
- Insect
- Periphyllus acericola
- Gene Symbol
- lrrfip2
- Assembly
- GCA_949715065.1
- Location
- OX454264.1:56155793-56156440[+]
Transcription Factor Domain
- TF Family
- LRRFIP
- Domain
- LRRFIP domain
- PFAM
- PF09738
- TF Group
- Unclassified Structure
- Description
- LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'- AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA [1]. LRRFIP2 may function as activator of the canonical Wnt signalling pathway, in association with DVL3, upstream of CTNNB1/beta-catenin [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 8.2e-12 5.5e-08 33.0 1.5 248 300 14 66 1 66 0.63 2 2 0.056 3.8e+02 0.7 0.2 122 161 66 105 64 107 0.68
Sequence Information
- Coding Sequence
- ATGCTCAATTGTTGCAATACGCTGGAGAGGGTTGTTAAGATGTACGACTCAAAAAAGTTGCAAGAAGCCAAACGTCATAGTGATAGCCATTACAACGGTACAGACTCAGACGATTTGGAAGATGCCCAAAAAGAAACAAACAATGTTCTTGGGGATTATAAATTCAAGTGGCAAAAGGCTGAACAAGACATTTCTACATTACAAGCAAATgtAGCAAGACTTGATAGTCAAGTTGTTAGATATAAAACGGCTTCTGAAGCAGCTGAAAAAGCTGAAGATGAACTTAAGttggaaaaaagaaaacttcAACGAGAGGTATTTAATTga
- Protein Sequence
- MLNCCNTLERVVKMYDSKKLQEAKRHSDSHYNGTDSDDLEDAQKETNNVLGDYKFKWQKAEQDISTLQANVARLDSQVVRYKTASEAAEKAEDELKLEKRKLQREVFN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -