Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 9.3e-21 7e-18 64.4 0.1 36 87 1 59 1 60 0.90

2 4 0.32 2.4e+02 1.8 0.1 19 68 73 122 69 137 0.73

3 4 0.87 6.6e+02 0.4 0.0 54 83 137 166 134 171 0.78

4 4 1.3 9.9e+02 -0.2 0.3 26 63 185 219 166 243 0.53

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	9.3e-21	7e-18	64.4	0.1	36	87	1	59	1	60	0.90
2	4	0.32	2.4e+02	1.8	0.1	19	68	73	122	69	137	0.73
3	4	0.87	6.6e+02	0.4	0.0	54	83	137	166	134	171	0.78
4	4	1.3	9.9e+02	-0.2	0.3	26	63	185	219	166	243	0.53

Coding Sequence: tttccatactatcgagataataaacaaggttggcaaaattctataagacataatttatcacttaatgattgttttataaaaattCCACGTGACAAATCAAATTCCAGTGATGATAATGAAAATGCAGCGGGTAAGGGTAGTTATTGGATGTTAGATTCATCTGCATGTGATATGTTTGAACAGGGAAATTATCGTAGAAGGCGTACACGAAGGCAACGGCATACAAAAATGTTACTTTCAGGACAATTACAGCATTCACAATTTTCATTTCCATATCATGAACTATTACAAACATCATCATCATCATCGATAGTACCAACAAATTTATCGCTTGATGAATGTGAACAAAATTTAGTAAAACGTGAAGAAAACAATTTTAATAATCAATTTGATCCTGAAAAAAATGAAAATATCATTTTAAATAAGACATACCATAAACAGGAAACTTTTCCAACTGAAAGTAATGAGTCTTGTATTAATGAATTACGAAAAAAATACTTAGCCAGTATCGATGCTTCATTAGACATTATACTGACAAGAAATTCAATAACATCAAATATAAATCATATAATTAAATCTAATAAAAATCAATTTGTAACGAAATCAAATTGTAATAATGATAGGAATTTATTAGATGAACAGCAGAAGTTTAGTACAAGTGAATCAGAAAAATTATTTTCAATAAAATCATCATTATTTACAATAGAAAATTTAATTAAGAAGGATAATGAATAA
Protein Sequence: FPYYRDNKQGWQNSIRHNLSLNDCFIKIPRDKSNSSDDNENAAGKGSYWMLDSSACDMFEQGNYRRRRTRRQRHTKMLLSGQLQHSQFSFPYHELLQTSSSSSIVPTNLSLDECEQNLVKREENNFNNQFDPEKNENIILNKTYHKQETFPTESNESCINELRKKYLASIDASLDIILTRNSITSNINHIIKSNKNQFVTKSNCNNDRNLLDEQQKFSTSESEKLFSIKSSLFTIENLIKKDNE

Sequence clustering based on sequence similarity using MMseqs2