Basic Information

Transcription Factor Domain

TF Family: PAX
Domain: PAX domain
PFAM: PF00292
TF Group: Helix-turn-helix
Description: The paired domain, a ~126 amino acid DNA-binding domain, is found in eukaryotic transcription regulatory proteins involved in embryogenesis. Initially identified in Drosophila’s paired (prd) protein, it typically resides in the N-terminal region and may be followed by an octapeptide, a homeodomain, or a Pro-Ser-Thr-rich C terminus. Paired domain proteins act as transcription repressors or activators, with DNA-binding specificity mediated by three subdomains. Crystal structures reveal a bipartite DNA-binding paired domain: an N-terminal subdomain (PAI) and a C-terminal subdomain (RED), linked by a flexible linker. Both subdomains contain a helix-turn-helix motif that binds DNA's major groove, while the linker may bind the minor groove. Variations in domain usage across Pax proteins and isoforms determine sequence specificity.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 5.4e-09 6.5e-06 27.2 0.0 23 95 5 80 1 100 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	5.4e-09	6.5e-06	27.2	0.0	23	95	5	80	1	100	0.85

Coding Sequence: AtggatttaaaacgaaattcaGTGATTGCTCTTTATTTGGAGGGAAAATCGAATATTGAAATACGTCGAGCGCTGCCAAATCTTCAATTGAACGAGAAATTTGTGCATCGCACTTTTCAACGTTATAATGAGACTGGTAGCGTTAAGAAACGCTACGGTGGCGGACGACGCTGTACTGCAACGGCGCCACCAGTTGTCGAAAAGGTGCGCCATCGATTAGACAGAAATCCAGCGCGCTCAGCAAACCAGCTCACGAAGGATCCCAAGGTGAGCGATCGCAGCGTTCTTCGCATATTAAAGGAAAAGCTTAAAGTCAAACcatga
Protein Sequence: MDLKRNSVIALYLEGKSNIEIRRALPNLQLNEKFVHRTFQRYNETGSVKKRYGGGRRCTATAPPVVEKVRHRLDRNPARSANQLTKDPKVSDRSVLRILKEKLKVKP

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00375183;
90% Identity: iTF_01331493; iTF_01334871; iTF_01246877; iTF_01246939; iTF_00701962; iTF_01246892; iTF_00375183; iTF_01246934;
80% Identity: -