Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.00014 0.64 9.8 0.2 20 49 71 100 50 103 0.73

2 4 0.00011 0.49 10.2 0.0 21 52 100 131 98 132 0.88

3 4 0.032 1.4e+02 2.3 0.0 21 47 128 154 126 159 0.84

4 4 0.00028 1.3 8.8 0.1 21 46 156 181 152 184 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.00014	0.64	9.8	0.2	20	49	71	100	50	103	0.73
2	4	0.00011	0.49	10.2	0.0	21	52	100	131	98	132	0.88
3	4	0.032	1.4e+02	2.3	0.0	21	47	128	154	126	159	0.84
4	4	0.00028	1.3	8.8	0.1	21	46	156	181	152	184	0.91

Coding Sequence: CTGATGAGCGCCCTAGCCATCGACTCTAAATTCCATCAAGGATTTAATTTGCCTCCTCACGAGATTGTAATTAAAATCGCGAGAGACGACACACCGCCGCCCCAGCAGCAAGAAGTGTACGCCAACCAACCTCTCGACCTAGGCCTCGATGCTCAACACACCTCTGGTGCTCATATGTCGAGAGCATTAAGTAGAACAATGAAATTGCCCAACTCTGAGAAACCATTTCAGTGTAACGTTTGCGAAAAGCAATTCCGTCAATTAAGCACCTTAACTAACCACATGAAGATTCATACGGGAGAAAAACCGTTTAAATGCACGGTTTGTGAAAAGCAGTTCCGGCAATCGAGTACGCTCACCAACCACATCAAGATTCACACGGGCGAAAAACCTTACAATTGCTCGTACTGTGGAAAACAATTCCGTCAATTAAGTACTCTAAGCAACCACACCAAGATCCACACGGGTGAAAAGCCGTTCGAGTGCGTCGTGTGTAAGAAGCAATTTCGCCAGTCTAGCACCTTAAATAACCACATCAAGATCCACACGCAATTAGCTATTAACTCTGAAAGAAGTGTACTTTTTCTAAAATCTTTTATTTGCTATCTGAAAAATAACATTATAACTGCGAGAAAAATTGAAAAAGATCAACAACTCAAAAGAATATCACAAAAAGGACTTAATCCCAGAATAAAAGAAAGCAAAAAGCAATCTGAGGCTGTGAAGTGCAAACAGGATATGAGAGATTATTGA
Protein Sequence: LMSALAIDSKFHQGFNLPPHEIVIKIARDDTPPPQQQEVYANQPLDLGLDAQHTSGAHMSRALSRTMKLPNSEKPFQCNVCEKQFRQLSTLTNHMKIHTGEKPFKCTVCEKQFRQSSTLTNHIKIHTGEKPYNCSYCGKQFRQLSTLSNHTKIHTGEKPFECVVCKKQFRQSSTLNNHIKIHTQLAINSERSVLFLKSFICYLKNNIITARKIEKDQQLKRISQKGLNPRIKESKKQSEAVKCKQDMRDY

Sequence clustering based on sequence similarity using MMseqs2