Porl052935.1
Basic Information
- Insect
- Parnassius orleans
- Gene Symbol
- -
- Assembly
- GCA_029286625.1
- Location
- JAGSMP010000443.1:215105-215548[+]
Transcription Factor Domain
- TF Family
- PAX
- Domain
- PAX domain
- PFAM
- PF00292
- TF Group
- Helix-turn-helix
- Description
- The paired domain, a ~126 amino acid DNA-binding domain, is found in eukaryotic transcription regulatory proteins involved in embryogenesis. Initially identified in Drosophila’s paired (prd) protein, it typically resides in the N-terminal region and may be followed by an octapeptide, a homeodomain, or a Pro-Ser-Thr-rich C terminus. Paired domain proteins act as transcription repressors or activators, with DNA-binding specificity mediated by three subdomains. Crystal structures reveal a bipartite DNA-binding paired domain: an N-terminal subdomain (PAI) and a C-terminal subdomain (RED), linked by a flexible linker. Both subdomains contain a helix-turn-helix motif that binds DNA's major groove, while the linker may bind the minor groove. Variations in domain usage across Pax proteins and isoforms determine sequence specificity.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 9.2e-10 8.7e-07 30.9 0.6 16 103 5 91 2 109 0.89
Sequence Information
- Coding Sequence
- ATGGGAAAAACACGCAAAATTAGCAGTGAAGTGCGTTCTGCCAtcgttgttttacataatgaagGCAAATCCGAACGTGAGATTGCTTTACAATTGAAGTTATCGAAGACTTGTGTTCATGGCACAATAACTCGATACAGGGAGACAGGCACTTTTCAAGATCGTCCACGCTCGGGAAGGCCGAGAGCTACCACGTCAAGTGAAGATCATTTCATTGTTGTTACCAGCAAGCGAAATAGACGCTTAACAGCACCGGAAATCCGCATTGAAGTAAACAAAACCCGAGTTAAACCTTTATCATTGACTACAGTAAAACGGCGACTGAGAGATGCGAAATTGTATGGTCGTGTTGCCGTTCGAAAACCTCTGCTAAGgccacaaaacaagaaaaaacggatgcaatgggcccttgcccatcgagattggactgaagaagatttttaa
- Protein Sequence
- MGKTRKISSEVRSAIVVLHNEGKSEREIALQLKLSKTCVHGTITRYRETGTFQDRPRSGRPRATTSSEDHFIVVTSKRNRRLTAPEIRIEVNKTRVKPLSLTTVKRRLRDAKLYGRVAVRKPLLRPQNKKKRMQWALAHRDWTEEDF
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01127361; iTF_01157729; iTF_01157735; iTF_01157727; iTF_01156418; iTF_01156421; iTF_01157765; iTF_01348805; iTF_01348811; iTF_01157738; iTF_00667436; iTF_00282319; iTF_01157760; iTF_00667439; iTF_01155152; iTF_00000307; iTF_01157730; iTF_01157713; iTF_00667444; iTF_01157716; iTF_00281237; iTF_00281236; iTF_00290677; iTF_01157717; iTF_00667448; iTF_01157737; iTF_01157742; iTF_00281232; iTF_01157744; iTF_00282321; iTF_01157748; iTF_01157749; iTF_00667447; iTF_01157759; iTF_01127351; iTF_01127352; iTF_01157753; iTF_00281244; iTF_01127356; iTF_00281229; iTF_01127357; iTF_00951806; iTF_01157747;
- 90% Identity
- iTF_01157747; iTF_00667444; iTF_01157729; iTF_01157730; iTF_01157763; iTF_01156421; iTF_01157735; iTF_01157737; iTF_01157738; iTF_00667437; iTF_01156418; iTF_00667440; iTF_01157744; iTF_01157713; iTF_01127346; iTF_00667439; iTF_01127352; iTF_01157715; iTF_01157748; iTF_01157717; iTF_01157749; iTF_01157759; iTF_00667447; iTF_01127351; iTF_00667448; iTF_01157742; iTF_01157723; iTF_01157760;
- 80% Identity
- -