Pmne058143.1
Basic Information
- Insect
- Parnassius mnemosyne
- Gene Symbol
- Ssb-c31a_1
- Assembly
- GCA_963668995.1
- Location
- CAVLGL010000126.1:38359582-38361484[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.7e-29 2e-24 86.8 1.0 1 51 43 93 43 94 0.96
Sequence Information
- Coding Sequence
- ATGCCTAAAAATAAGAAGAAACCAGAAAGTTCCAGCAGTGACAGTGATGACGGTCCCGTTGATAGAAATCCGCCAGCAGAGAAAAAAGCTAAAATGGGCTCCAGGACAGAAGATAAAGAGCCAACTTGGGTCCTGCAAGGTAAAAAGTTGGTAAAAGTAAGAGAGTTCAAGGGCAAGGTCTATGTAGATATAAgagaattttatgaaaaaaatggaGAATTATTACCAGGAAAGAAAGGCATCAGTTTAACACCTGAACAGTGGAGGAAGCTCTTGTCTTTAGGAGATGAAATTAACGAAGCTGTCAGTTCCTCATGTTAA
- Protein Sequence
- MPKNKKKPESSSSDSDDGPVDRNPPAEKKAKMGSRTEDKEPTWVLQGKKLVKVREFKGKVYVDIREFYEKNGELLPGKKGISLTPEQWRKLLSLGDEINEAVSSSC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01076532;
- 90% Identity
- iTF_01155222; iTF_01157817; iTF_01140225; iTF_01141702; iTF_01146278; iTF_01148839; iTF_01145291; iTF_01147406; iTF_01143856; iTF_01140947; iTF_01142419; iTF_01144564; iTF_01148123; iTF_01130056; iTF_01264648; iTF_01143120; iTF_01176208; iTF_00922900; iTF_01154008; iTF_00195195; iTF_01138971; iTF_01149627; iTF_01402747; iTF_00204381; iTF_01494336; iTF_01495803;
- 80% Identity
- iTF_01155222; iTF_01157817;