Basic Information

Transcription Factor Domain

TF Family: PC4
Domain: PC4 domain
PFAM: PF02229
TF Group: Unclassified Structure
Description: This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 6.6e-05 0.85 9.7 0.2 7 27 46 66 42 72 0.84

2 5 9.3e-05 1.2 9.2 0.1 9 27 91 109 87 115 0.84

3 5 9.3e-05 1.2 9.2 0.1 9 27 134 152 130 158 0.84

4 5 9.3e-05 1.2 9.2 0.1 9 27 177 195 173 201 0.84

5 5 9.3e-05 1.2 9.2 0.1 9 27 220 238 216 244 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	6.6e-05	0.85	9.7	0.2	7	27	46	66	42	72	0.84
2	5	9.3e-05	1.2	9.2	0.1	9	27	91	109	87	115	0.84
3	5	9.3e-05	1.2	9.2	0.1	9	27	134	152	130	158	0.84
4	5	9.3e-05	1.2	9.2	0.1	9	27	177	195	173	201	0.84
5	5	9.3e-05	1.2	9.2	0.1	9	27	220	238	216	244	0.84

Coding Sequence: ATGAATGTCTCGTCACAGACCGAGTCGCCCGCTGGTCGCGGGCTCTTTGTCGGTTGTTCTTTGTGTTGTTATTGTGGTTGTCGTTGCGTTCTGTTCTGTAGAAGTCGTTTGTTTTTGGAGTTTGGTAGCAGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGTCGTTGGTTCAACGTTCAAAAATCGTCCTGGGGTTCAAATTCGGAACCCAAGTTACGTAG
Protein Sequence: MNVSSQTESPAGRGLFVGCSLCCYCGCRCVLFCRSRLFLEFGSRFKFVVGSTFKNRPGVQIRRWFNVQKSSWGSNSSLVQRSKIVLGFKFVVGSTFKNRPGVQIRRWFNVQKSSWGSNSSLVQRSKIVLGFKFVVGSTFKNRPGVQIRRWFNVQKSSWGSNSSLVQRSKIVLGFKFVVGSTFKNRPGVQIRRWFNVQKSSWGSNSSLVQRSKIVLGFKFVVGSTFKNRPGVQIRRWFNVQKSSWGSNSSLVQRSKIVLGFKFGTQVT

Sequence clustering based on sequence similarity using MMseqs2