Pphe016911.1
Basic Information
- Insect
- Papilio phestus
- Gene Symbol
- bs_3
- Assembly
- GCA_018231625.1
- Location
- DVQH01008165.1:3804-4304[+]
Transcription Factor Domain
- TF Family
- SRF
- Domain
- SRF domain
- PFAM
- PF00319
- TF Group
- Helix-turn-helix
- Description
- Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.4e-10 2.6e-06 28.3 0.5 1 23 113 135 113 136 0.95
Sequence Information
- Coding Sequence
- ATGGACGCTCCCGGCGGAGCGCGGGAGCCCCGCTTCGGGTCGCCGTACGGTATGGGACTCCTTGGGGACGTCGGTGATATGTACGGCGCGGGCCGGCCGCCCAGCTCGCTCGGCGGCGGTGGGCTGAGGCCGGGGATGCAGCCCTGCCCGGTGCCTCGGGCCGGCGTTAAGCGACCCTCGGACCAGTGCTACGACGAGAGACCTTCGCAGAGTCTCGGTCTGGAACACTGCCCCATGCCTGACATAGCAGACGATGGTTATGCATCTCTTCAACCCAAGAAGTCTCCCCCATCCAATGGCAAGAAGACAAAAGGACGTGTTAAGATCAAGATGGAGTACATAGACAATAAACTCCGGCGATATACAACATTCTCCAAGCGGAAGACTGGCATCATGAAGAAGGTGGGTCGCAGACGGTTTTGGCAATATTTCATACATCAGCCAAGTGGACTATGTGACCATACTGTGCTGGGTGTCTATCTACCTGGTACCATACACTAG
- Protein Sequence
- MDAPGGAREPRFGSPYGMGLLGDVGDMYGAGRPPSSLGGGGLRPGMQPCPVPRAGVKRPSDQCYDERPSQSLGLEHCPMPDIADDGYASLQPKKSPPSNGKKTKGRVKIKMEYIDNKLRRYTTFSKRKTGIMKKVGRRRFWQYFIHQPSGLCDHTVLGVYLPGTIH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01166676;
- 90% Identity
- iTF_01145249; iTF_00323490; iTF_00180454; iTF_00195141; iTF_00922854; iTF_01402694; iTF_00957927; iTF_01495756; iTF_00249678; iTF_01494287; iTF_01495023; iTF_01496560; iTF_01139578; iTF_01115678; iTF_01176159; iTF_01130005; iTF_00855865; iTF_00144551; iTF_01133708; iTF_00871271; iTF_00412489; iTF_00680522; iTF_00409261; iTF_00411441; iTF_00410264; iTF_00772860; iTF_00148446; iTF_00149376; iTF_01135734; iTF_01134770; iTF_01072474; iTF_00289594; iTF_00654266; iTF_01245917; iTF_01153004; iTF_00025223; iTF_00255885; iTF_00256895; iTF_01156430; iTF_01155170; iTF_01157770; iTF_01158940; iTF_01337730; iTF_00971349; iTF_00970385; iTF_01148789; iTF_00840278; iTF_01564634; iTF_00277339; iTF_00795685; iTF_00166899; iTF_01082420; iTF_01438907; iTF_01437962; iTF_00288027; iTF_00197342; iTF_01141645;
- 80% Identity
- iTF_01139578;