Pphe038486.1
Basic Information
- Insect
- Papilio phestus
- Gene Symbol
- rfx7.L_2
- Assembly
- GCA_018231625.1
- Location
- DVQH01051676.1:1-1872[-]
Transcription Factor Domain
- TF Family
- RFX
- Domain
- RFX domain
- PFAM
- PF02257
- TF Group
- Basic Domians group
- Description
- RFX is a regulatory factor which binds to the X box of MHC class II genes and is essential for their expression. The DNA-binding domain of RFX is the central domain of the protein and binds ssDNA as either a monomer or homodimer [1]. It recognize X-boxes (DNA of the sequence 5'-GTNRCC(0-3N)RGYAAC-3', where N is any nucleotide, R is a purine and Y is a pyrimidine) using a highly conserved 76-residue DNA-binding domain (DBD) [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 6.1e-29 4.6e-25 89.5 0.0 2 68 53 119 52 119 0.98
Sequence Information
- Coding Sequence
- CAAGAAGGTCGTCAAAGAGTAACCCAATTGTTAGAAGCAGTAGAGGCTCTGAGTGGTGCTGAGAGACTTTTACTCTATCTTCGTCTGCCAACAGGTGTTCCACCTCATGATCCTTTGAAACAACCAATTAATCCATTGGGTTCAAGAGCGGAACTACAACAAACTGTAACATGGATACAAACACACTTGGAAGTGGATCCAGATGTTTCATTACCAAAGCAAGATGTTTATGATGAATATATAGCTCATTGCATGAGTAGCAACATGAAGCCTTTATCAACAGCTGATTTCGGCAAAGTTATGAAGCAAGTTTATCCAAGTGTTCGTCCCCGTCGTCTGGGAACACGAGGCAACTCTAG
- Protein Sequence
- QEGRQRVTQLLEAVEALSGAERLLLYLRLPTGVPPHDPLKQPINPLGSRAELQQTVTWIQTHLEVDPDVSLPKQDVYDEYIAHCMSSNMKPLSTADFGKVMKQVYPSVRPRRLGTRGNS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01207847;
- 90% Identity
- iTF_01207847;
- 80% Identity
- -