Pdar012372.1
Basic Information
- Insect
- Papilio dardanus
- Gene Symbol
- e2f7
- Assembly
- GCA_013186455.1
- Location
- QDHC01003372.1:1131480-1133920[-]
Transcription Factor Domain
- TF Family
- E2F
- Domain
- E2F_TDP domain
- PFAM
- PF02319
- TF Group
- Helix-turn-helix
- Description
- This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 1.3e-15 6.3e-12 45.1 0.2 23 65 2 44 1 44 0.96 2 3 1.8 8.7e+03 -3.4 0.0 12 29 51 67 49 68 0.64 3 3 5.9e-17 2.8e-13 49.4 0.1 1 64 79 169 79 170 0.90
Sequence Information
- Coding Sequence
- ATGAAAATTCAATTAGACAGCACTGCGGCCAGGTTGGGAGTAGGAAAACGCAGAATGTATGacataatcaatattttagaaGCGATGAAGTATGCAGTccatgaaaagaaaaatacatatttgtgGCATGGCGAGGCTGGCCTTAGTTCCTTtctaaaaattcttaaaaaacaaGGGGAAAGTCTACGCTTATCCGAGGCTTTGAGAGGGAGAGCGCCCAAGCCTCCGCCACCAAAACACAAAACACTGGGAATACTGGCCAAAAGAttcttaatgttatttttagttgaACCACCAAATACTCTAATAAATTTAGAGATGGCTGTGAAGGTACTAATAGACACctcaaatagaaataaaactgaTCTCTCTCCAGAGCAGCTGGACCGCCAACACAAGTCTAAAGTGCGAAGGCTCTACGATATTGCcaacatatttatatcaattggTCTCATTGAAAAGGTTTCCggtaatttgatattaaagaaGCCGGTATTCAAATATGTCGGTAGATATAAGGTTAATAGATTTGACGACACAAAAACACCATCACCAATAACACCCCTGTCTGCTCTAGACACACATCAGAAATTAACCCCTTGCTATGTTTATGCGGGTAGATCGAAACGAAAGTTAGAGTTCACTACCCCGAGTAATCACAAACTCGGGGTCACCACACCCCCACATACACCATCACACAAGTGGGATGAGATCCTACTGGTAGCCGATATGGAGTTGAGTAGGATTAATAAAGGAGTTTAG
- Protein Sequence
- MKIQLDSTAARLGVGKRRMYDIINILEAMKYAVHEKKNTYLWHGEAGLSSFLKILKKQGESLRLSEALRGRAPKPPPPKHKTLGILAKRFLMLFLVEPPNTLINLEMAVKVLIDTSNRNKTDLSPEQLDRQHKSKVRRLYDIANIFISIGLIEKVSGNLILKKPVFKYVGRYKVNRFDDTKTPSPITPLSALDTHQKLTPCYVYAGRSKRKLEFTTPSNHKLGVTTPPHTPSHKWDEILLVADMELSRINKGV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -