Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 3.7e-05 0.56 10.2 0.1 13 31 95 112 92 128 0.82

2 5 5.3e-06 0.082 12.8 0.1 21 52 143 174 132 175 0.87

3 5 0.0029 44 4.1 0.1 23 45 173 192 170 198 0.67

4 5 0.0032 50 3.9 0.1 21 45 196 220 189 223 0.83

5 5 0.00015 2.3 8.2 0.1 21 43 224 246 222 253 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	3.7e-05	0.56	10.2	0.1	13	31	95	112	92	128	0.82
2	5	5.3e-06	0.082	12.8	0.1	21	52	143	174	132	175	0.87
3	5	0.0029	44	4.1	0.1	23	45	173	192	170	198	0.67
4	5	0.0032	50	3.9	0.1	21	45	196	220	189	223	0.83
5	5	0.00015	2.3	8.2	0.1	21	43	224	246	222	253	0.91

Coding Sequence: ATGGAAAACCTCTGCCGATGTTGTCACTCTCACTACGGCTTTAAGAGTCTTAATACATCTTATGCATACGAAGGAACAGAAGAAACTTATTCGACGATGTTGCAAAAGACTTTCGACATTATTGTGAGTCCAGTAATAGGAGAGTTAAATACTATCTCTTACTCTATCTGTGATGTATGCATTGCTCATTTACAAGATGCACTAATATTTAAGAAGCAAGTGGTCAGTTGTGAACAATTACTGTATACACATTATAGTGCCTTAGGTTATAAAGATGAGATCTCAAAACCTAGAAGTCGGAACCAATCCAAGAAATATACATGTGATGTCTGTTGTAAACAATTTACTTATTATGGTTCATTAGAAGTACATTTACTCACACATAACGATAATGGTTATTTAAAGATTCATATGCGTGTACACACTGGTGAGAAACCGTACACTTGTGAAGTGTGTAAACGTTCTTTCAGAGAGACAGGGCAATTGAAACGTCATATGAGAGTACACACGGGTATAAAACCGTACACATGTAAGATATGTAATAAACAAATAGGTAATTTGTCTAAACATATGCGTGTACATTCTGATGAAAGGCCGTACAACTGTAATATATGTAATAAACAATTTACTATAAATGGTAATTTGAAACTCCATATGAGAATACATACTGGAGAGAGACCATTTGCCTGTGATTTATGTAACAGCCAATTTACACAGAGCAGTGGACTTAAACGGCATAGATGTACACATGTTGATAAAGTGAATCCGTAA
Protein Sequence: MENLCRCCHSHYGFKSLNTSYAYEGTEETYSTMLQKTFDIIVSPVIGELNTISYSICDVCIAHLQDALIFKKQVVSCEQLLYTHYSALGYKDEISKPRSRNQSKKYTCDVCCKQFTYYGSLEVHLLTHNDNGYLKIHMRVHTGEKPYTCEVCKRSFRETGQLKRHMRVHTGIKPYTCKICNKQIGNLSKHMRVHSDERPYNCNICNKQFTINGNLKLHMRIHTGERPFACDLCNSQFTQSSGLKRHRCTHVDKVNP

Sequence clustering based on sequence similarity using MMseqs2