Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00077 4.7 7.5 0.0 23 44 36 57 31 61 0.90

2 6 0.0049 31 4.9 0.0 21 48 62 88 58 92 0.87

3 6 0.037 2.3e+02 2.0 0.1 23 47 120 144 110 150 0.80

4 6 0.028 1.7e+02 2.5 0.1 21 43 146 168 138 172 0.83

5 6 0.00034 2.1 8.6 0.1 21 52 174 205 167 207 0.86

6 6 0.00036 2.2 8.5 0.0 21 44 202 225 198 234 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00077	4.7	7.5	0.0	23	44	36	57	31	61	0.90
2	6	0.0049	31	4.9	0.0	21	48	62	88	58	92	0.87
3	6	0.037	2.3e+02	2.0	0.1	23	47	120	144	110	150	0.80
4	6	0.028	1.7e+02	2.5	0.1	21	43	146	168	138	172	0.83
5	6	0.00034	2.1	8.6	0.1	21	52	174	205	167	207	0.86
6	6	0.00036	2.2	8.5	0.0	21	44	202	225	198	234	0.87

Coding Sequence: ATGAAAACGCATATAACAGTTAAAGCGCATGTTTGCAAGACATGTGGACGCAGTTTCGCACGTCCTGAACAACTGAAAAACCACATGAATGTACATTTAGGAAGCAAACCGCATATTTGTGAGATTTGTTTCAAAGGATTCAATCAAATATCGAATTTAAAGGATCATATGCGGACGCATAATGGCGAACGACCATTTTTATGTTCAACATGCGGTAAAGGATTTAATCAATTGGGAAATTTGCGGCAACATACAATCCGACACAGTGGCATTAAAGCGCATTTGTGCAGTACATGTGGTAGTGGATTTGCTAGTAAAGGAGAATTGTCTGCACATTTACGAAAACATAcaggTGCTCGTCCGTTTGTTTGTTCAATATGTAATCACGGCTTTACAACATCCAGTTCATTAACGAAACACAAACGTATTCACTCCGGTGAAAAGCCTTACGAATGTGATGTatgcaaaatgaaattttcacgTTCGGGTATTTTAGCACGCCACAAACGAacacatactggtgaaaaaccgtACATCTGTAAATTTTGTTCGAAAGCATTTTCACAATCGAACGATTTAACATCACATTTACGCATACATACCGGCGAAAAACCGTATATATGCGATGTGTGCGGACACGCATTTCGACAAAGTTCCGGTCTTAAAGCACACAAGAAAACACACATTGACAAACAAGATGTAGTGGATAATAATAgacgtaataaaattattacattgtttaattga
Protein Sequence: MKTHITVKAHVCKTCGRSFARPEQLKNHMNVHLGSKPHICEICFKGFNQISNLKDHMRTHNGERPFLCSTCGKGFNQLGNLRQHTIRHSGIKAHLCSTCGSGFASKGELSAHLRKHTGARPFVCSICNHGFTTSSSLTKHKRIHSGEKPYECDVCKMKFSRSGILARHKRTHTGEKPYICKFCSKAFSQSNDLTSHLRIHTGEKPYICDVCGHAFRQSSGLKAHKKTHIDKQDVVDNNRRNKIITLFN

Sequence clustering based on sequence similarity using MMseqs2