Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0027 12 6.1 0.2 20 44 36 60 18 67 0.82

2 5 0.0025 11 6.2 0.0 23 51 67 95 63 96 0.84

3 5 6.5e-05 0.29 11.3 0.2 21 46 93 118 91 120 0.91

4 5 0.0012 5.5 7.2 0.4 21 47 121 147 117 152 0.83

5 5 0.00029 1.3 9.2 0.0 20 45 148 173 147 181 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0027	12	6.1	0.2	20	44	36	60	18	67	0.82
2	5	0.0025	11	6.2	0.0	23	51	67	95	63	96	0.84
3	5	6.5e-05	0.29	11.3	0.2	21	46	93	118	91	120	0.91
4	5	0.0012	5.5	7.2	0.4	21	47	121	147	117	152	0.83
5	5	0.00029	1.3	9.2	0.0	20	45	148	173	147	181	0.88

Coding Sequence: ATGATCGGGATGATAAGATTTTTTAGTTCAAAGGTATTGGAGTGTACTTTGTGccagaaaataatgaaatcccCTGGAGCATTTTATAGACACATACGCACACATACGGGTGAAAAGCCTTATCAGTGTGAGTTATGTCACAAGAAGTTTTCTCAACAGAGTAACTTATGGAAACATGCACTTATACATACAGgtgaaagaaaatttaaatgtccAACATGTAACAAAAAGTTTTCTCAAAGAGCTAATATGCAGAAACATATGATGTTGCATACTGGTGAAAAACCATTCACATGCTATATTTGTTCCCGAACATTTACCCAAAGagctaatttaaacaaacacattCGCATACATACAGGCGAGAAGCCATATACATGCAGATTTTGTAGCCGTCAATTTGCTCAACAGTCAAACATGCAGAAACATGAATTACTGCATCAAGGCATAAAACCATTTAGTTGCAACTTATGTACTACATCCTTTACTCAACAgagcaatttgaaaaaacatttaaaatccCATTCCAATGTTAATGGAGTACGAAATAGAAGAGAGTACAAGTGTCAGAAATGTAATAGAAATTATGGTACCAAAAGTAGTTTGTATAAACATATGCggaaatgtttagaaaatgatAAGGAAGGCGTAGTGGTTAACAGTAGTGGAGAGGGTTCTCATAACAGTAATGCTGTCAGTACCAATCAATTCCTAAACGAATTCAATTATGTGATAAGAAAGGACTTGGACACATGA
Protein Sequence: MIGMIRFFSSKVLECTLCQKIMKSPGAFYRHIRTHTGEKPYQCELCHKKFSQQSNLWKHALIHTGERKFKCPTCNKKFSQRANMQKHMMLHTGEKPFTCYICSRTFTQRANLNKHIRIHTGEKPYTCRFCSRQFAQQSNMQKHELLHQGIKPFSCNLCTTSFTQQSNLKKHLKSHSNVNGVRNRREYKCQKCNRNYGTKSSLYKHMRKCLENDKEGVVVNSSGEGSHNSNAVSTNQFLNEFNYVIRKDLDT

Sequence clustering based on sequence similarity using MMseqs2