Olae009897.1
Basic Information
- Insect
- Orius laevigatus
- Gene Symbol
- ZIPIC_3
- Assembly
- GCA_018703685.1
- Location
- JAGWEN010000292.1:34488-34973[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0022 0.88 9.8 0.0 20 45 20 45 7 52 0.80 2 5 0.65 2.6e+02 1.9 0.4 22 36 50 64 45 76 0.65 3 5 0.023 9 6.5 0.1 17 46 73 102 60 106 0.80 4 5 0.094 37 4.6 0.1 21 44 106 129 102 133 0.80 5 5 0.0056 2.2 8.5 0.0 18 46 131 159 124 161 0.88
Sequence Information
- Coding Sequence
- ATGTGCCAGTTTGAGTGTTTCAGTCCCTCCAAACTGAAGGTGCATGCTAGAACTCATACTGGAGAAAAGCCCTACAAATGCGATATTTGTGAGGCTAAGTTTTCCCAGTTGGGCAATATGAAGGCACACGTGAGAGCTCATATAGGAGATAAGCCTTACAAATGCGATATTTGTGAAGCAAGCTTTTCGGATCCGAGTTCCAGGAAGACGCACATGAGACGTCACACTGGAGAAAGGCCTTATAAATGCACGTTTTGTGAGGCCAAGTTTACTATGTCGACCCATCTAAAGGTGCACATCATGAGAGCCCATACTGGAGAGAAGCCTTATAAATGTGATATTTGTGAAGCTAGTTTTTCCGATACGAGCACTATAAAGGTCCACATGAGACGCCACACTGGAGAAAAGCCTTACGAATGCAAGATTTGCGAGGCCAGGTTCACATATTCCGGTCAAGTAAAAAAGCATATGAAAATTCACTCTTAA
- Protein Sequence
- MCQFECFSPSKLKVHARTHTGEKPYKCDICEAKFSQLGNMKAHVRAHIGDKPYKCDICEASFSDPSSRKTHMRRHTGERPYKCTFCEAKFTMSTHLKVHIMRAHTGEKPYKCDICEASFSDTSTIKVHMRRHTGEKPYECKICEARFTYSGQVKKHMKIHS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01108649;
- 90% Identity
- iTF_01108649;
- 80% Identity
- iTF_01108649;