Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.4 1.6e+02 2.6 0.1 21 34 5 18 3 28 0.78

2 5 0.017 6.7 6.9 0.0 21 51 33 63 23 66 0.83

3 5 2.9 1.2e+03 -0.2 0.1 21 32 61 72 57 89 0.73

4 5 0.028 11 6.2 0.0 21 43 89 111 71 116 0.87

5 5 0.0029 1.1 9.4 0.0 22 51 118 147 112 148 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.4	1.6e+02	2.6	0.1	21	34	5	18	3	28	0.78
2	5	0.017	6.7	6.9	0.0	21	51	33	63	23	66	0.83
3	5	2.9	1.2e+03	-0.2	0.1	21	32	61	72	57	89	0.73
4	5	0.028	11	6.2	0.0	21	43	89	111	71	116	0.87
5	5	0.0029	1.1	9.4	0.0	22	51	118	147	112	148	0.88

Coding Sequence: ATGATCCACACAGGTGAAAAGCCATTCAAATGTCAAATCTGCAGTGCCAGATTTTCCGAGTTATTTTCTTTAAAAACACATGGTAGGACCCACACTGGAGAAAAGCCTTATAAATGTGATGTCTGTGATGCTGCATTCACATCAGGAAAAATTTTGAAAAATCATATAAGGGTCCATACAGGAGAGAAGCCATATAAATGTGTTGTCTGCAATAGATCATTTGCTACATGGGGAACTTTACAATTTCATTTGAGAACCCACACAGGAGAGAAGCCATTTAAATGTGATACATGCGATGCCGCATTCACAAGATCCTACTCTTTGAAAAAGCATGGGAGAATCCACATAGGAGAAAAGCCTTTCAAATGTGATTTCTGCAATGCTTCATTCGCCACATCAGGACCTTTAAAAAGGCATATAAAGATCCACTCAGGAGACAAGCCATTATAA
Protein Sequence: MIHTGEKPFKCQICSARFSELFSLKTHGRTHTGEKPYKCDVCDAAFTSGKILKNHIRVHTGEKPYKCVVCNRSFATWGTLQFHLRTHTGEKPFKCDTCDAAFTRSYSLKKHGRIHIGEKPFKCDFCNASFATSGPLKRHIKIHSGDKPL

Sequence clustering based on sequence similarity using MMseqs2