Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.17 65 3.8 0.1 25 34 24 33 18 39 0.86

2 5 0.00029 0.11 12.6 0.3 17 52 75 109 68 109 0.82

3 5 0.0019 0.73 10.0 0.0 21 51 106 136 104 137 0.87

4 5 0.00099 0.39 10.9 0.0 21 51 134 164 129 167 0.85

5 5 6.1 2.4e+03 -1.2 0.0 22 48 163 188 160 190 0.74

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.17	65	3.8	0.1	25	34	24	33	18	39	0.86
2	5	0.00029	0.11	12.6	0.3	17	52	75	109	68	109	0.82
3	5	0.0019	0.73	10.0	0.0	21	51	106	136	104	137	0.87
4	5	0.00099	0.39	10.9	0.0	21	51	134	164	129	167	0.85
5	5	6.1	2.4e+03	-1.2	0.0	22	48	163	188	160	190	0.74

Coding Sequence: ATGGATATTGAATTAAAAATTGAGGATAATTCATTGGATATAAAAGAGGAAGAGATGACTTATTCTTGTACCACCTGTGATGTTTGTTATTCGACGATTGGTGAGCTTCAAGGACATGTTGGTGTGCATGATCCGAAATTGGAGGAAGAAAGTAAAAAGCACGTGTGTGGGCTCTGCGGGAAGGATTTTACGCGACGGTATTCCCTGACGAAACATGAGAGGTCGCACACTGGCGAAAGGCCGTATTCGTGCGCTCTCTGTGAGAGAAGATTTAACGATTCTAAAGACCTCAAACGACACGTTCGACTCCACACGGGCGAGAAGCCATATTCGTGTAAGTTCTGCGATTCAAAATTTAACCAGTCGACCGGCCTCAAACGTCACGAACGTCTCCACACAGGAGAGAAGCCCTACGAGTGCGATTTCTGTGAAAAGAAGTTCACCCAGTCATCCGACTTGAGACGACATGAACGGATGCACACTGGAGACAAACCTTTTATTTGTAAACTCTGCCCTAAAAAGTTCACCCATTCTTCCCACTTGACGAATCATGAAGCGACTCATTTTTTATGTACATAA
Protein Sequence: MDIELKIEDNSLDIKEEEMTYSCTTCDVCYSTIGELQGHVGVHDPKLEEESKKHVCGLCGKDFTRRYSLTKHERSHTGERPYSCALCERRFNDSKDLKRHVRLHTGEKPYSCKFCDSKFNQSTGLKRHERLHTGEKPYECDFCEKKFTQSSDLRRHERMHTGDKPFICKLCPKKFTHSSHLTNHEATHFLCT

Sequence clustering based on sequence similarity using MMseqs2