Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.22 86 3.4 0.1 22 49 7 34 4 40 0.83

2 7 0.011 4.4 7.5 0.0 21 48 35 62 32 66 0.86

3 7 0.005 2 8.6 0.0 21 44 63 86 59 94 0.85

4 7 0.037 14 5.9 0.0 21 50 91 120 85 122 0.87

5 7 0.012 4.6 7.5 0.0 21 44 119 142 116 146 0.91

6 7 0.0062 2.4 8.3 0.1 26 45 151 170 144 173 0.90

7 7 0.059 23 5.2 0.0 21 46 174 199 172 203 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.22	86	3.4	0.1	22	49	7	34	4	40	0.83
2	7	0.011	4.4	7.5	0.0	21	48	35	62	32	66	0.86
3	7	0.005	2	8.6	0.0	21	44	63	86	59	94	0.85
4	7	0.037	14	5.9	0.0	21	50	91	120	85	122	0.87
5	7	0.012	4.6	7.5	0.0	21	44	119	142	116	146	0.91
6	7	0.0062	2.4	8.3	0.1	26	45	151	170	144	173	0.90
7	7	0.059	23	5.2	0.0	21	46	174	199	172	203	0.87

Coding Sequence: ATGATGGTCCATACAGGCGAGAAGCTCTACACGTGCCAAGTTTGCGCAAAGAAGTTTTCTAGAGCAGAGCATTTGAAGAAACATATTATGATCGTCCATACTGGAGAAAAGCCGTACGTGTGCGAAGTTTGTGGAAAGAAGTTCTCTCAAGCTACCAATTTAAAGCTGCACGTCAGAATGCACACGGGAGAGAAACCATACACTTGTGAAATCTGCGGCATGAAGTTTGCGCAACTCAGCAATCTCAAGTGCCATTCTGTAATCCACACCGGAGAGAAACCCTACGGGTGTGAAATTTGCGAGAAGAGGTTCACCCAGCATAGTACGCTGAAGACGCATATGAAAATCCATACGGGGGAGAAACCGTTCGGGTGTACGATTTGCGAGATGAGTTTTACCCGAGTTGGAGATTTGAGGAGACACATGGGGACCCATACTGGAGACTTCTACACGTGCGAAATCTGCGATAAGAAGTTCACACAGCGACGAAATCTTAAGAGTCATACGAAAATACATACAGGGGAGAAACCGTACAGTTGCGAAATATGCGAAAAGAAGTTCATCACAGGTAGCGATTTGAGAAAACATGTCAAAGTCCATCTTCCAAAGTTAATGGTTAAAAAGTGA
Protein Sequence: MMVHTGEKLYTCQVCAKKFSRAEHLKKHIMIVHTGEKPYVCEVCGKKFSQATNLKLHVRMHTGEKPYTCEICGMKFAQLSNLKCHSVIHTGEKPYGCEICEKRFTQHSTLKTHMKIHTGEKPFGCTICEMSFTRVGDLRRHMGTHTGDFYTCEICDKKFTQRRNLKSHTKIHTGEKPYSCEICEKKFITGSDLRKHVKVHLPKLMVKK

Sequence clustering based on sequence similarity using MMseqs2