Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 5.5e-05 0.45 12.3 0.1 26 48 119 141 111 146 0.88

2 5 0.00032 2.6 9.9 0.1 26 47 147 168 141 173 0.86

3 5 0.0054 44 5.9 0.0 26 46 175 195 168 200 0.83

4 5 0.0084 68 5.3 0.1 26 46 231 251 225 257 0.91

5 5 0.033 2.7e+02 3.4 0.2 26 45 265 284 252 287 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	5.5e-05	0.45	12.3	0.1	26	48	119	141	111	146	0.88
2	5	0.00032	2.6	9.9	0.1	26	47	147	168	141	173	0.86
3	5	0.0054	44	5.9	0.0	26	46	175	195	168	200	0.83
4	5	0.0084	68	5.3	0.1	26	46	231	251	225	257	0.91
5	5	0.033	2.7e+02	3.4	0.2	26	45	265	284	252	287	0.88

Coding Sequence: ATGAACACTCAACAACACACGGTTAGCATTGATGTGAAGGGCGAAGATACAACAAATTATGAGAAgtttgaagaaatttatattaaagaagaacagCTGGCAGAAAACTCCCAggacaaaaaattatatgacaAAGAATGTGACAACTCatttactataaataatgatattcaaaaaactGAACGTACTAAATTAAAGAGTTTTTGTTGTACAAAGTGTAAAAAGAGTTTTACAAGAAAGGCAAGGTTGAATATGCATATGAAAATacacgaagaaaataaattcgATTGTTCAGTATGTGAAAAAATAAGTCCACCAGAAAGTGATTTAAAATATCGTATGAGACGACATGTACATTGTCCTACTTGTAATAAATTAGTGAtagacaaaaaaaatttaagggctCATATGGAACTTCATACTTCAACTAAGGAATATCAATGTACGgtgtgttataaattattttggatGAATCGTAGTTTAATTAGGCATATGGAAATTCACTCTGAAACAAAAGCATTTAAGTgtccgacatgtaataaatcatttacacaaaaggttaatttagaaaaacatatgaaaattcacagtggAATAAAAGACTATAAGTGTGAAAcatgcaataaattatttacactgAATTCTCATTTAAAAGACCATATGCGAATTCACAGTGGAATAAAAGACTATAAGTGtgcaatatgcaataaacaatttacgcAAAGTAGTCATCTATtcagacatatgaaaattcatagtgacAGTGAGACTAAGAAATATCGGAGGAAATTTCAATGTTCGATTTGTGAAAAATCATATACACAAAAGTCTCATCTCAAAAGACATATGAACACTCATAGCAGTGACATTAATTCTGAATGA
Protein Sequence: MNTQQHTVSIDVKGEDTTNYEKFEEIYIKEEQLAENSQDKKLYDKECDNSFTINNDIQKTERTKLKSFCCTKCKKSFTRKARLNMHMKIHEENKFDCSVCEKISPPESDLKYRMRRHVHCPTCNKLVIDKKNLRAHMELHTSTKEYQCTVCYKLFWMNRSLIRHMEIHSETKAFKCPTCNKSFTQKVNLEKHMKIHSGIKDYKCETCNKLFTLNSHLKDHMRIHSGIKDYKCAICNKQFTQSSHLFRHMKIHSDSETKKYRRKFQCSICEKSYTQKSHLKRHMNTHSSDINSE

Sequence clustering based on sequence similarity using MMseqs2