Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 2.7 3.9e+04 -2.0 0.1 13 23 16 26 12 30 0.69

2 5 0.038 5.4e+02 4.0 0.2 22 49 37 64 34 67 0.85

3 5 3.6e-06 0.052 16.8 0.1 21 52 64 95 61 96 0.89

4 5 0.0075 1.1e+02 6.2 0.0 21 52 92 123 90 124 0.88

5 5 0.00022 3.1 11.1 0.1 21 46 120 145 116 150 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	2.7	3.9e+04	-2.0	0.1	13	23	16	26	12	30	0.69
2	5	0.038	5.4e+02	4.0	0.2	22	49	37	64	34	67	0.85
3	5	3.6e-06	0.052	16.8	0.1	21	52	64	95	61	96	0.89
4	5	0.0075	1.1e+02	6.2	0.0	21	52	92	123	90	124	0.88
5	5	0.00022	3.1	11.1	0.1	21	46	120	145	116	150	0.90

Coding Sequence: ATGCTTTTTGAATCAGCATCATTGCACACCGACAACTCGCAAGAGGAGCGACCTATGTCACGAGAAgctaaagaagaaaaaattactGTAGGTGATGGTGGTACCCTAGATAAGCCGTTCCAATGTAACGTGTGTGAGAGACGTTTTAGACAATTAAGCACCTTAACGAATCATGTTAAAATTCACACTGGTGAAAAACCGTACAAATGTCCTGTTTGCGAAAAACATTTTCGTCAGTCCAGCACTTTGACGAATCATTTGAAAATCCATACAGGCGAAAAACCCTTCAACTGTACATATTGCGGGAAGCAATTCCGCCAGTTGAGTACTCTTACCAATCATTTGAAAATTCACACGGGCGAAAAACCGTTTGAATGTATCATTTGTAAAAAACAATTCCGTCAATCGAGCACGCTCAATAATCACATCAAAATTCATATGACCGATAAACTTTTCATCACGTGTACACCTGAAATTAAAGCTGAAATAATTGACGAAGCTTGA
Protein Sequence: MLFESASLHTDNSQEERPMSREAKEEKITVGDGGTLDKPFQCNVCERRFRQLSTLTNHVKIHTGEKPYKCPVCEKHFRQSSTLTNHLKIHTGEKPFNCTYCGKQFRQLSTLTNHLKIHTGEKPFECIICKKQFRQSSTLNNHIKIHMTDKLFITCTPEIKAEIIDEA

Sequence clustering based on sequence similarity using MMseqs2