Basic Information

Transcription Factor Domain

TF Family: Fork_head
Domain: Fork_head domain
PFAM: PF00250
TF Group: Helix-turn-helix
Description: The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.1e-16 2.1e-13 51.2 0.0 30 81 2 50 1 57 0.90

2 3 0.6 1.2e+03 0.7 0.1 38 52 70 83 63 86 0.76

3 3 2.3 4.4e+03 -1.1 0.0 43 52 99 108 88 112 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.1e-16	2.1e-13	51.2	0.0	30	81	2	50	1	57	0.90
2	3	0.6	1.2e+03	0.7	0.1	38	52	70	83	63	86	0.76
3	3	2.3	4.4e+03	-1.1	0.0	43	52	99	108	88	112	0.72

Coding Sequence: atgaactaCAGCGCcgAAAGGTTCCCGTTCTTCAGGCCTCAAGACGACAGGTGGAAGAACTCAGTACGTCACAACCTGTCTATCAATCCTCACTTCAGGAAAGGGGCCAAAGCTGCTAAAGGAGCAGGCCACCTGTGGACTATAGCTGCTCCGAGTGCTGCTTTGGATCGAGTTCTGGCTTCTTGCGAAGCGCGTCGAAGGAACGAGATCTCGAGGAAGGCCCCAACCAGATGGAGTAACCTGATCAGGACTGCGAAGGGATCTTCAATATCAGATCCTCTCCGATTGGCCCGGGACAGATCTAAATGGAAGGAGACCATTAAAAGGGTCATCGACGGCTGCCACCATCCTTAG
Protein Sequence: MNYSAERFPFFRPQDDRWKNSVRHNLSINPHFRKGAKAAKGAGHLWTIAAPSAALDRVLASCEARRRNEISRKAPTRWSNLIRTAKGSSISDPLRLARDRSKWKETIKRVIDGCHHP

Sequence clustering based on sequence similarity using MMseqs2